(data stored in ACNUC31108 zone)

EMBL: BC057639

ID   BC057639; SV 1; linear; mRNA; STD; MUS; 1350 BP.
XX
AC   BC057639;
XX
DT   18-SEP-2003 (Rel. 77, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 12)
XX
DE   Mus musculus tetraspanin 11, mRNA (cDNA clone MGC:67784 IMAGE:4218418),
DE   complete cds.
XX
KW   MGC.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1350
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-1350
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (03-SEP-2003) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; 1de0524c00071276d3f010ed6c28630b.
DR   Ensembl-Gn; ENSMUSG00000030351; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0031317; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0031288; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0031216; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0031295; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0031019; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0031752; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0030400; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0030980; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0031136; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0031085; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0031216; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0031124; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0031787; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0030115; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0030485; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000032501; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0080319; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0080398; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0080320; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0080335; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0079959; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0080802; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0080533; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0079910; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0080067; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0079942; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0080105; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0079960; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0081067; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0079964; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0079051; mus_musculus_wsbeij.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Jeffrey E. Green, M.D.
CC   cDNA Library Preparation: Life Technologies, Inc.
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: Sequencing Group at the Stanford Human Genome
CC   Center, Stanford University School of Medicine, Stanford, CA  94305
CC   Web site:       http://www-shgc.stanford.edu
CC   Contact:  (Dickson, Mark) mcd@paxil.stanford.edu
CC   Dickson, M., Schmutz, J., Grimwood, J., Rodriquez, A., and Myers,
CC   R. M.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAK Plate: 120 Row: k Column: 14
CC   This clone was selected for full length sequencing because it
CC   passed the following selection criteria: matched mRNA gi: 31541797.
CC   Differences found between this sequence and the mouse C57BL/6J
CC   genome (build 36) are described in misc_difference features below.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1350
FT                   /organism="Mus musculus"
FT                   /lab_host="DH10B"
FT                   /strain="FVB/N"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NCI_CGAP_Co24"
FT                   /clone="MGC:67784 IMAGE:4218418"
FT                   /tissue_type="Colon, normal. 5 month old male mouse."
FT                   /note="Vector: pCMV-SPORT6"
FT                   /db_xref="taxon:10090"
FT   gene            1..1350
FT                   /gene="Tspan11"
FT   CDS_pept        111..872
FT                   /codon_start=1
FT                   /gene="Tspan11"
FT                   /product="tetraspanin 11"
FT                   /db_xref="GOA:Q9D1D1"
FT                   /db_xref="InterPro:IPR000301"
FT                   /db_xref="InterPro:IPR008952"
FT                   /db_xref="InterPro:IPR018499"
FT                   /db_xref="MGI:MGI:1915748"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9D1D1"
FT                   /protein_id="AAH57639.1"
FT                   /translation="MAHCKTEQDDWLLAHLKYLLFIFNFFFWVGGAAVMAVGIWTLVEK
FT                   SGYLSILASSTFAASAYILIFVGGLVMTTGFLGFGAIIREQKSCLSTYFCLLLVIFLVE
FT                   LVAGVLAHVYYQRLSDELKWHLNSTLTEHYGQPRAAEITASVDRLQQDFKCCGSNSSAD
FT                   WQHSAYILSQEALGRQVPDSCCKTVVARCGQRAHPSNIYKVEGGCMAKLEQFVADHLLL
FT                   MGAVGIGVACLQICGMVLTCCLHRRLQQQFY"
FT   misc_difference 1240..1350
FT                   /gene="Tspan11"
FT                   /note="polyA tail: 111 bases do not align to the mouse
FT                   genome."
XX
SQ   Sequence 1350 BP; 349 A; 372 C; 364 G; 265 T; 0 other;
     ggagcgcagg gtggagcggg cggctgtggc caggacagcc acaatcacag ctccggattc        60
     ccgatccctc gctgcatcca gcctggcggt tttggccggg tccagccgcc atggcgcact       120
     gcaagacaga gcaggatgac tggctgctgg cccacctgaa gtacctgctc ttcatcttca       180
     acttcttctt ctgggtaggt ggggcagccg tcatggccgt gggtatctgg acactggtgg       240
     agaagagcgg ttacctcagc atcttggcct ccagcacgtt cgctgcctct gcctacatcc       300
     tcattttcgt tggtggtctt gtcatgacaa ctggcttcct gggctttggg gccatcatcc       360
     gggagcagaa gagctgcctc tccacatatt tctgcctgct gctggtcatc ttccttgtgg       420
     agctggtggc aggggtcctg gcacatgtgt actaccagag gctgagtgac gagctgaagt       480
     ggcacctgaa cagcaccctg actgagcact acggacagcc cagggccgca gagatcacag       540
     cctcggtgga ccggctgcag caggacttca aatgctgtgg cagtaacagc tcagccgact       600
     ggcagcacag cgcgtacatc ttgtctcagg aagccctggg tcgccaggtg cccgacagct       660
     gctgcaagac agtggtggcc cgctgtggtc agcgagccca cccctccaac atctacaagg       720
     tagagggagg ctgtatggcc aagctggaac agttcgtggc tgaccacctg ctgctcatgg       780
     gagcggtggg tattggggta gcctgtcttc agatctgtgg gatggtcctc acctgctgct       840
     tgcaccgaag gctccagcaa caattttatt aaaggacacc catgtaccct gctgactggc       900
     ccacccaagg gaccacatct ccacttcctg aaccaggcct gcaaagtcat cgctggggct       960
     gtggactcgc tccaccctat gcagaggcca ccaaatgtct gtggttgtgg ttcctgtgca      1020
     tcccgactgg caggggcctc agctaactcc tccattccta agtactcagc cactgccaaa      1080
     atccttgcca agggatgatc ctggccagag gcagccagag ccctttgcca ggcactggga      1140
     cgctgtggac tacagggggg ccagagctca tctccctctg atccatctca gtgtctgagt      1200
     ctggaataga aggccgtcgg atggtccctc tgagagtcca aaaaaaaaaa aaaaaaaaaa      1260
     aaaaaaaaaa aaaaaaaaaa aaaaaaaaaa aaaaaaaaaa aaaaaaaaaa aaaaaaaaaa      1320
     aaaaaaaaaa aaaaaaaaaa aaaaaaaaaa                                       1350
//

If you have problems or comments...

PBIL Back to PBIL home page