(data stored in ACNUC10243 zone)

EMBL: BC057655

ID   BC057655; SV 1; linear; mRNA; STD; MUS; 949 BP.
XX
AC   BC057655;
XX
DT   18-SEP-2003 (Rel. 77, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 7)
XX
DE   Mus musculus heterogeneous nuclear ribonucleoprotein A3, mRNA (cDNA clone
DE   IMAGE:3496518), partial cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-949
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-949
RA   Director MGC Project;
RT   ;
RL   Submitted (03-SEP-2003) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Cancer
RL   Genomics Office, National Cancer Institute, 31 Center Drive, Room 11A03,
RL   Bethesda, MD 20892-2590, USA
XX
DR   MD5; ca3ce9a52ca1ad08e5d1cdab9eedbd74.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Lothar Hennighausen Ph.D., Robin Humphreys
CC   cDNA Library Preparation: Life Technologies, Inc.
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: Sequencing Group at the Stanford Human Genome
CC   Center, Stanford University School of Medicine, Stanford, CA  94305
CC   Web site:       http://www-shgc.stanford.edu
CC   Contact:  (Dickson, Mark) mcd@paxil.stanford.edu
CC   Dickson, M., Schmutz, J., Grimwood, J., Rodriquez, A., and Myers,
CC   R. M.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAK Plate: 120 Row: b Column: 5
CC   This clone was selected for full length sequencing because it
CC   passed the following selection criteria: matched mRNA gi: 22122656.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..949
FT                   /organism="Mus musculus"
FT                   /lab_host="DH10B"
FT                   /strain="mix FVB/N, C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NCI_CGAP_Mam5"
FT                   /clone="IMAGE:3496518"
FT                   /tissue_type="Mammary tumor. WAP-TGF alpha model. 7 months
FT                   old, gross tissue."
FT                   /note="Vector: pCMV-SPORT6"
FT                   /db_xref="taxon:10090"
FT   gene            1..>949
FT                   /gene="Hnrpa3"
FT                   /note="synonyms: MGC37309, hnRNPA3"
FT   CDS_pept        39..>949
FT                   /codon_start=1
FT                   /gene="Hnrpa3"
FT                   /product="Hnrpa3 protein"
FT                   /db_xref="GOA:Q6PFA7"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR034513"
FT                   /db_xref="InterPro:IPR034516"
FT                   /db_xref="InterPro:IPR035979"
FT                   /db_xref="MGI:MGI:1917171"
FT                   /db_xref="UniProtKB/TrEMBL:Q6PFA7"
FT                   /protein_id="AAH57655.1"
FT                   /translation="MEGHDPKEPEQLRKLFIGGLSFETTDDSLREHFEKWGTLTDCVVM
FT                   RDPQTKRSRGFGFVTYSCVEEVDAAMCARPHKVDGRVVEPKRAVSREDSVKPGAHLTVK
FT                   KIFVGGIKEDTEEYNLRDYFEKYGKIETIEVMEDRQSGKKRGFAFVTFDDHDTVDKIVV
FT                   QKYHTINGHNCEVKKALSKQEMQSAGSQRGRGGGSGNFMGRGGNFGGGGGNFGRGGNFG
FT                   GRGGYGGGGGGSRGSYGGGDGGYNGFGGDGGNYGGGPGYSSRGGYGGGGPGYGNQGGGY
FT                   GGGGGGYDGYNEKKKKKKKKKK"
XX
SQ   Sequence 949 BP; 294 A; 115 C; 305 G; 235 T; 0 other;
     attgaactcg agttggaaga ggcgagtccg gtctcaaaat ggagggccat gatccaaagg        60
     aaccagagca gctgaggaag ctatttattg gtggtctgag ctttgaaacc acagatgata       120
     gcttaagaga acattttgag aaatggggca cacttacaga ctgtgtggta atgagagatc       180
     cccaaacaaa acgttccaga ggctttggtt ttgtgaccta ctcttgtgtt gaagaggtgg       240
     atgctgcaat gtgtgctcgg ccacacaagg ttgatgggcg tgtggtggaa ccgaagagag       300
     ctgtttctag agaggattct gtaaagcctg gtgcccattt aacggtgaag aaaatttttg       360
     ttggtggtat taaagaggat acggaagaat ataacctgag agactacttt gaaaagtatg       420
     gcaagattga aaccatagag gttatggaag acaggcagag tgggaaaaag agaggatttg       480
     cttttgtaac ttttgatgat catgacacag ttgataaaat tgttgttcag aaataccaca       540
     ctattaatgg gcataattgt gaagtgaaaa aggccctttc taaacaagag atgcagtctg       600
     ctggatcaca gagaggtcgt ggaggtggat ctggcaactt tatgggtcgt ggaggaaact       660
     ttggaggtgg tggaggaaac tttggtcgtg gaggaaactt tggtggaaga ggtggctatg       720
     gtggtggagg tggtggcagc agaggtagtt atggaggtgg tgatggtgga tataatggat       780
     ttggaggtga tggtggcaac tatggtggtg gtcctggtta cagcagtaga ggaggttatg       840
     gaggtggtgg accaggatat ggaaaccagg gtggtggata tggtggtgga ggaggaggct       900
     atgatggtta taatgaaaaa aaaaaaaaaa aaaaaaaaaa aaaaaaaaa                   949
//

If you have problems or comments...

PBIL Back to PBIL home page