(data stored in ACNUC31108 zone)

EMBL: BC059144

ID   BC059144; SV 1; linear; mRNA; STD; ROD; 1232 BP.
XX
AC   BC059144;
XX
DT   11-OCT-2003 (Rel. 77, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 7)
XX
DE   Rattus norvegicus CD37 molecule, mRNA (cDNA clone MGC:72894 IMAGE:6887407),
DE   complete cds.
XX
KW   MGC.
XX
OS   Rattus norvegicus (Norway rat)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Rattus.
XX
RN   [1]
RP   1-1232
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-1232
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (01-OCT-2003) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; 44ac158d215f2e06605d275306d67a75.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: John C. Marshall, M.D., Ph.D
CC   cDNA Library Preparation: CLONTECH Laboratories, Inc.
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: Genome Sequence Centre,
CC   BC Cancer Agency, Vancouver, BC, Canada
CC   info@bcgsc.bc.ca
CC   Martin Hirst, Thomas Zeng, Ryan Morin, Michelle Moksa, Johnson
CC   Pang, Diana Mah, Jing Wang, Kieth Fichter, Eric Chuah, Allen
CC   Delaney, Rob Kirkpatrick, Agnes Baross, Sarah Barber, Mabel
CC   Brown-John, Steve S. Chand, William Chow, Ryan Babakaiff, Dave
CC   Wong, Corey Matsuo, Jaclyn Beland, Susan Gibson, Luis delRio, Ruth
CC   Featherstone, Malachi Griffith, Obi Griffith, Ran Guin, Nancy Liao,
CC   Kim MacDonald,  Mike R. Mayo, Josh Moran, Diana Palmquist, JR
CC   Santos, Duane Smailus, Jeff Stott, Miranda Tsai, George Yang,
CC   Jacquie Schein, Asim Siddiqui,Steven Jones, Rob Holt, Marco Marra.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAL Plate: 52 Row: b Column: 18
CC   This clone was selected for full length sequencing because it
CC   passed the following selection criteria: matched mRNA gi: 8393072.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1232
FT                   /organism="Rattus norvegicus"
FT                   /lab_host="DH10B"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NICHD_Rr_Pit1"
FT                   /clone="MGC:72894 IMAGE:6887407"
FT                   /tissue_type="Pituitary gland, anterior, rat"
FT                   /note="Vector: pDNR-LIB"
FT                   /db_xref="taxon:10116"
FT   gene            1..1232
FT                   /gene="Cd37"
FT                   /note="synonym: MRC OX-44"
FT   CDS_pept        99..944
FT                   /codon_start=1
FT                   /gene="Cd37"
FT                   /product="CD37 molecule"
FT                   /db_xref="GOA:P31053"
FT                   /db_xref="InterPro:IPR000301"
FT                   /db_xref="InterPro:IPR008952"
FT                   /db_xref="InterPro:IPR018499"
FT                   /db_xref="InterPro:IPR018503"
FT                   /db_xref="UniProtKB/Swiss-Prot:P31053"
FT                   /protein_id="AAH59144.1"
FT                   /translation="MSAQESCLSLIKYFLFVFNLFFFVLGGLIFCFGTWILIDKTSFVS
FT                   FVGLSFVPLQTWSKVLSVSGVLTMALALLGCVGALKELRCLLGLYFGMLLLLFATQITL
FT                   GILISTQRVRLERRVQELVLRTIQSYRTNPDETAAEESWDYAQFQLRCCGWQSPRDWNK
FT                   AQMLKANGSEELFVPCSCYNSTATNDSSGFDKLFLSQLSRLGPRAKLRQTADICALPAK
FT                   AHIYREGCARSLQKWLHNNIISIVGICLGVGLLELGFMTLSIFLCRNLDHVYDRLARYR
FT                   "
XX
SQ   Sequence 1232 BP; 242 A; 382 C; 301 G; 307 T; 0 other;
     gggggagtct ttctctgtcc attatccccc ttcccccctg tggccaacac ctcttctgtc        60
     tgggttcctc aagctgctcg ctccccatct aggcgaagat gtccgcccaa gagagttgcc       120
     tcagcctcat caagtacttc ctcttcgttt tcaacctctt cttctttgta ctaggaggcc       180
     tgattttctg ctttggcacc tggatcctca ttgacaagac cagcttcgtg tcctttgtgg       240
     gcttgtcctt cgtgccactg cagacctggt ccaaggtcct gtcggtctcg ggtgtcctca       300
     ccatggccct ggctctcctg ggctgtgtgg gggctctaaa ggagctgcgc tgtcttctgg       360
     gcctgtattt cggaatgctg ctgctcctgt ttgccacaca gattaccttg gggatcctca       420
     tttccactca gcgagtccgg ctggagcgaa gggtgcagga attggtgtta cggaccatcc       480
     agagctaccg cacgaatccg gatgagacag ctgctgagga gagctgggac tatgcgcagt       540
     ttcagctgcg ctgctgcggt tggcaatctc cgcgggactg gaacaaggcc cagatgctga       600
     aagcaaacgg gtccgaagag ctctttgtgc cctgctcctg ctacaattcc accgcgacca       660
     atgactcctc cggctttgat aagctctttc tctcccagct aagccggctg gggccgcggg       720
     cgaagctgag gcagactgct gacatatgtg cactccccgc aaaagcccat atataccgtg       780
     agggctgcgc gcggagcctc cagaagtggc tgcacaacaa tatcatctcc atagtgggaa       840
     tttgtctggg agtcggtctt cttgagctcg gcttcatgac actctcgata ttcctgtgta       900
     gaaatctgga tcacgtctat gaccggctgg cccggtaccg ctaggcccca acccaccggt       960
     tggcacccac gcacctccat gcagtcagga actgtttcct tcctggttgg ttacaggctt      1020
     ggagccctgt gcctcaggcc tcattctctg gggacccaga tgtctgccct aagacagcct      1080
     tcacttcccc cacagggcca gggactttcg agcccagctt ccttccctgc tccctcctcc      1140
     ccacaccatc tgtctgccac ctcccacatg acacctcaaa taaatcccct tcttttttgg      1200
     ttaaaaaaaa aaaaaaaaaa aaaaaaaaaa aa                                    1232
//

If you have problems or comments...

PBIL Back to PBIL home page