(data stored in ACNUC24361 zone)

EMBL: BC060248

ID   BC060248; SV 1; linear; mRNA; STD; MUS; 3505 BP.
XX
AC   BC060248;
XX
DT   28-OCT-2003 (Rel. 77, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 6)
XX
DE   Mus musculus zinc finger with KRAB and SCAN domains 5, mRNA (cDNA clone
DE   MGC:67150 IMAGE:5715760), complete cds.
XX
KW   MGC.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-3505
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-3505
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (20-OCT-2003) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; 21f3bc7b784b99da61176ff705e80e64.
DR   Ensembl-Gn; ENSMUSG00000055991; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0030363; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0030332; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0030264; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0030349; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0030060; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0030794; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0029465; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0030030; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0030180; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0030135; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0030269; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0030166; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0030834; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0029180; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0029540; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000031601; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0075841; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0075917; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0075821; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0075866; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0075486; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0076326; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0076030; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0075437; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0075595; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0075486; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0075641; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0075498; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0076574; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0075481; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0074618; mus_musculus_wsbeij.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Dr. Jim Lin, University of Iowa
CC   cDNA Library Preparation: M. Bento Soares, University of Iowa
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: Genome Sequence Centre,
CC   BC Cancer Agency, Vancouver, BC, Canada
CC   info@bcgsc.bc.ca
CC   Martin Hirst, Thomas Zeng, Ryan Morin, Michelle Moksa, Johnson
CC   Pang, Diana Mah, Jing Wang, Kieth Fichter, Eric Chuah, Allen
CC   Delaney, Rob Kirkpatrick, Agnes Baross, Sarah Barber, Mabel
CC   Brown-John, Steve S. Chand, William Chow, Ryan Babakaiff, Dave
CC   Wong, Corey Matsuo, Jaclyn Beland, Susan Gibson, Luis delRio, Ruth
CC   Featherstone, Malachi Griffith, Obi Griffith, Ran Guin, Nancy Liao,
CC   Kim MacDonald,  Mike R. Mayo, Josh Moran, Diana Palmquist, JR
CC   Santos, Duane Smailus, Jeff Stott, Miranda Tsai, George Yang,
CC   Jacquie Schein, Asim Siddiqui,Steven Jones, Rob Holt, Marco Marra.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAK Plate: 124 Row: n Column: 23
CC   This clone was selected for full length sequencing because it
CC   passed the following selection criteria: matched mRNA gi: 46409653.
CC   Differences found between this sequence and the mouse C57BL/6J
CC   genome (build 36) are described in misc_difference features below.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3505
FT                   /organism="Mus musculus"
FT                   /lab_host="DH10B"
FT                   /strain="C57BL/6"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NIH_BMAP_FC0"
FT                   /clone="MGC:67150 IMAGE:5715760"
FT                   /tissue_type="Mouse, brain 12.5 dpc"
FT                   /note="Vector: pYX-ASC"
FT                   /db_xref="taxon:10090"
FT   gene            1..3505
FT                   /gene="Zkscan5"
FT                   /note="synonym: hKraba1"
FT   misc_difference 1..3
FT                   /gene="Zkscan5"
FT                   /note="3 bases at the 5' end do not align to the mouse
FT                   genome."
FT   misc_difference 374
FT                   /gene="Zkscan5"
FT                   /note="1 base in cDNA is not found in the mouse genome."
FT   CDS_pept        632..2872
FT                   /codon_start=1
FT                   /gene="Zkscan5"
FT                   /product="Zkscan5 protein"
FT                   /db_xref="GOA:Q6PAK4"
FT                   /db_xref="InterPro:IPR003309"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR036236"
FT                   /db_xref="InterPro:IPR038269"
FT                   /db_xref="MGI:MGI:107533"
FT                   /db_xref="UniProtKB/TrEMBL:Q6PAK4"
FT                   /protein_id="AAH60248.1"
FT                   /translation="MIMTESRAVIHLEPPAETSQEQADLLIVKVEEEDCSWMQGYNRPV
FT                   LETFYQRFKHFQYHEAAGPRDALSQLRVLCCEWLRPELHTKEQILELLVLEQFLTILPE
FT                   EFQAWVREHHPESGEEAVAVIESIQRELEERRQQIATSPEVLPQKMVPPGATQESFSHQ
FT                   CLPVEAQPERESQNLLEENDYEPKEGNLEFTVQQVSDAADPHWVAAERTEKNGVQRPES
FT                   GEVSDLKDMVPRWQVNPTSGNPRQKRPLRSGPDVNRKQKSNGERGHRCGDCGKFFLQAS
FT                   NFIQHRRIHTGEKPFKCGECGKSYNQRVHLTQHQRVHTGEKPYKCQVCGKAFRVSSHLV
FT                   QHHSVHSGERPYGCNECGKSFGRHSHLIEHLKRHFREKSQRCSDRRSKNTKLNIKQIPG
FT                   LSEADLELSGEVQRNACQAEGHSEGCEHQDGQQGVVMKETLGQSSSKRTDCNEFSYVHK
FT                   KSSPGERPHQCNECGKSFIQSAHLIQHRRIHTGEKPFRCEECGKSYNQRVHLTQHHRVH
FT                   TGEKPYACHLCGKAFRVRSHLVQHQSVHSRERPFKCNECGKGFGRRSHLAGHLRLHSRD
FT                   KSHQCHECGEIFFQYVSLLEHQVLHVGQKSEKNGICEEAYSWNLTVIKDKKLELQEQPY
FT                   QCDSCGKAFSYSSDLIQHYRTHSAEKPQKCDACRDSTCQCPHIKQQQKSCPSGKSHQCN
FT                   ECGRGFSLKSHLSQHQRIHTGEKPLQCKECGMSFSWSCSLFKHLRSHERTDP"
FT   misc_difference 3474..3505
FT                   /gene="Zkscan5"
FT                   /note="polyA tail: 32 bases do not align to the mouse
FT                   genome."
XX
SQ   Sequence 3505 BP; 980 A; 849 C; 918 G; 758 T; 0 other;
     gccgctggta ggacattgtg tccacactgg agtcctgtcc ctaaccttga cccggctggt        60
     ctctgtctcc aggtcaggag ctattacaaa gaatccaggt ccaaattttt tagtataacc       120
     gtacttctca tagaactaat gaagtctttc gtttatctat caagctctta tggcttgaaa       180
     gccagaatga gatatgacca ttttaatggg tttcattcct atactgactt cagtttggct       240
     tatgatcgag agaagaaacg actccgtctg gaataatttt gtcccgttat ttatatgaga       300
     tatggacttt ctcattttta aaactgtttt aagttgggcc tgatgtcact ttttaatggc       360
     cttttttttt ttttacgtta ttaaaatctg gacgtagtcg ctattagctg ttttatggga       420
     gaagtgatga ctaacttctc tatatcttaa agtgaatgac tttgttgagt ggtttttctt       480
     tagtctagat gacgtcgttg ccacctctct tagctaataa taattccaga cattccagta       540
     aggttgttca ctacaaaaag tgccctttag aagagcagag aacaaatcgg gttagtgtaa       600
     cgggctagag tctagagact cttcagttgg aatgataatg acagaatcca gggcagttat       660
     acacttagag cctcccgctg agacttcgca agagcaagca gaccttctca tagtgaaagt       720
     agaagaagag gactgctcct ggatgcaggg atacaaccgg ccagtgcttg agacttttta       780
     ccagcgcttc aagcacttcc agtaccatga ggcagcagga ccccgcgatg ctctcagcca       840
     gctccgggtt ctctgttgtg agtggctgag gccggagctg cacaccaaag agcagatcct       900
     ggagctgctg gtgctggagc agttcctcac catcctgcct gaagagtttc aggcctgggt       960
     gagagagcat caccccgaga gtggggaaga agccgtggct gtgatagaga gtatccagag      1020
     agagctggag gagcgcagac aacagattgc cacaagtccc gaagtacttc ctcagaagat      1080
     ggtaccaccc ggagccacgc aggagtcctt cagtcaccag tgtctacctg tggaggccca      1140
     gcccgagcga gagtcacaga atcttctgga agaaaatgat tacgagccca aggagggcaa      1200
     cttagagttc acggtgcagc aggtctccga tgcagctgac ccacactggg tggccgcaga      1260
     acgcacggaa aagaatggtg ttcagcgtcc agagtccggc gaagtcagcg acctgaagga      1320
     catggtgccg aggtggcagg tgaatcccac ttcggggaat ccaaggcaga aaagacctct      1380
     gcgctcaggt ccggatgtta accggaagca gaaatcgaat ggcgaacgag gccacagatg      1440
     tggtgactgc gggaagtttt tcctccaagc ctcaaacttc attcagcacc ggaggatcca      1500
     cactggagag aaaccgttta aatgtgggga gtgtggaaaa agctacaacc agcgggttca      1560
     cctcactcag caccagagag tccacaccgg cgagaagccc tacaagtgtc aggtgtgcgg      1620
     gaaagccttc cgtgtgagct cccatctggt gcagcatcac agcgtgcaca gcggggagag      1680
     gccgtatggc tgtaacgagt gcgggaagag ctttgggcgg cactcgcatc tgatcgagca      1740
     tctgaagcgc cacttcagag agaaatccca aagatgcagc gacagaagaa gtaagaacac      1800
     taaactaaac attaagcaaa ttccaggact ttcagaagca gacctggaac tatcgggaga      1860
     agtccaaagg aatgcttgcc aggctgaagg tcacagtgag ggctgtgaac accaggatgg      1920
     acagcagggg gttgtcatga aagaaaccct agggcagtcc tcttcaaaga ggacagactg      1980
     caatgagttc agctatgtcc acaagaagtc gtctccagga gagaggccac accaatgtaa      2040
     cgagtgcggg aaaagcttca tccagagcgc gcacctcatt cagcatcgga gaatccatac      2100
     tggggagaaa ccattcaggt gcgaggagtg tgggaagagc tacaaccaac gtgtccacct      2160
     cactcaacat caccgcgttc acacgggcga gaagccctat gcctgtcact tatgtgggaa      2220
     agccttccga gtgaggtccc acctcgttca acaccagagt gtgcacagca gggagaggcc      2280
     cttcaagtgc aacgagtgtg ggaagggctt cgggaggcgt tcgcatctcg ccgggcacct      2340
     ccgactccac tctagagaca agtcacacca gtgtcacgag tgtggtgaga tctttttcca      2400
     gtacgtcagc ctccttgaac accaagtgct ccatgtgggc cagaagagcg agaagaacgg      2460
     tatctgcgag gaggcctaca gctggaacct gacggtgatc aaagataaga agctggagtt      2520
     acaggagcag ccttaccagt gcgactcctg cggcaaagcc ttcagttaca gttctgacct      2580
     cattcagcat tacagaactc actctgcgga gaaaccccag aaatgcgacg catgcaggga      2640
     cagcacctgc cagtgtccgc acataaaaca gcaacagaaa agctgcccca gtgggaaatc      2700
     ccatcagtgc aatgagtgtg gaaggggctt cagtctgaag tcccatctca gtcaacatca      2760
     gagaatccac accggcgaga agcccctcca gtgtaaggag tgtggaatga gtttcagttg      2820
     gagctgtagc ctcttcaaac atctgcgtag ccacgagagg acagatccat aagcacctga      2880
     agcatacagg agtctgttgg gaagcggcct ggctttagag aagccttcca tggctctcat      2940
     atgtgtaaca gcatcttagc catcttaacc atcagaccta cagacgaggg gaagccctgt      3000
     caggtagagc ttagccttca gggacactgg agcatcccag gtgctccgat agcatcttta      3060
     cgctcggaac ctctggctag gcacggcggt gctcacctgt atgcctcggg agggagagac      3120
     aggcaaacat ctggtttaca tagcaagttc caggccagcc agatctacat agtgagaccc      3180
     ctgggtgaga gacagacaga cagacagaca cctctgggtc ctgtggataa aggaaagtct      3240
     tgacatggca ttgtttattt gaagctcaga aaaataacaa agagtcatga gtgcagtaga      3300
     cataagctca tttgtagttt ccacctcaac agcatagcta ctcagagagt cgtccctcca      3360
     aaggaactct tccgcgtgaa gcccatcttg gtacatctct ggacacgact gccccagcca      3420
     ctggagtact ctagccattg tcccatcctg tttattaaaa cgtttgaaaa gaaaaaaaaa      3480
     aaaaaaaaaa aaaaaaaaaa aaaaa                                            3505
//

If you have problems or comments...

PBIL Back to PBIL home page