(data stored in ACNUC16935 zone)

EMBL: BC060312

ID   BC060312; SV 1; linear; mRNA; STD; ROD; 1199 BP.
XX
AC   BC060312;
XX
DT   23-OCT-2003 (Rel. 77, Created)
DT   12-JUN-2008 (Rel. 96, Last updated, Version 6)
XX
DE   Rattus norvegicus ubiquitin B, mRNA (cDNA clone MGC:72686 IMAGE:6919609),
DE   complete cds.
XX
KW   MGC.
XX
OS   Rattus norvegicus (Norway rat)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Rattus.
XX
RN   [1]
RP   1-1199
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-1199
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (20-OCT-2003) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; 961208ce4675931e2a4a17aea02b11ea.
DR   EuropePMC; PMC2043549; 17761534.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: John C. Marshall, M.D., Ph.D
CC   cDNA Library Preparation: CLONTECH Laboratories, Inc.
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: Genome Sequence Centre,
CC   BC Cancer Agency, Vancouver, BC, Canada
CC   info@bcgsc.bc.ca
CC   Martin Hirst, Thomas Zeng, Ryan Morin, Michelle Moksa, Johnson
CC   Pang, Diana Mah, Jing Wang, Kieth Fichter, Eric Chuah, Allen
CC   Delaney, Rob Kirkpatrick, Agnes Baross, Sarah Barber, Mabel
CC   Brown-John, Steve S. Chand, William Chow, Ryan Babakaiff, Dave
CC   Wong, Corey Matsuo, Jaclyn Beland, Susan Gibson, Luis delRio, Ruth
CC   Featherstone, Malachi Griffith, Obi Griffith, Ran Guin, Nancy Liao,
CC   Kim MacDonald,  Mike R. Mayo, Josh Moran, Diana Palmquist, JR
CC   Santos, Duane Smailus, Jeff Stott, Miranda Tsai, George Yang,
CC   Jacquie Schein, Asim Siddiqui,Steven Jones, Rob Holt, Marco Marra.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAL Plate: 52 Row: j Column: 1
CC   This clone was selected for full length sequencing because it
CC   passed the following selection criteria: matched mRNA gi: 20302084.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1199
FT                   /organism="Rattus norvegicus"
FT                   /lab_host="DH10B"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NICHD_Rr_Pit1"
FT                   /clone="MGC:72686 IMAGE:6919609"
FT                   /tissue_type="Pituitary gland, anterior, rat"
FT                   /note="Vector: pDNR-LIB"
FT                   /db_xref="taxon:10116"
FT   gene            1..1199
FT                   /gene="Ubb"
FT                   /note="synonym: UBC"
FT   CDS_pept        103..1020
FT                   /codon_start=1
FT                   /gene="Ubb"
FT                   /product="ubiquitin B"
FT                   /db_xref="GOA:P0CG51"
FT                   /db_xref="InterPro:IPR000626"
FT                   /db_xref="InterPro:IPR019954"
FT                   /db_xref="InterPro:IPR019956"
FT                   /db_xref="InterPro:IPR029071"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0CG51"
FT                   /protein_id="AAH60312.1"
FT                   /translation="MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIF
FT                   AGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKA
FT                   KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGK
FT                   TITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV
FT                   LRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDG
FT                   RTLSDYNIQKESTLHLVLRLRGGY"
XX
SQ   Sequence 1199 BP; 327 A; 340 C; 308 G; 224 T; 0 other;
     ggggagtgac gagaggcttt gtccggttcc gaggtctttc tgtgagggtg tttcgacgcg        60
     ctgggcggtt tgttccttca tcgcattcgt taacaggtca aaatgcaaat cttcgtgaag       120
     accctgaccg gcaagaccat caccctagag gtggagccca gtgacaccat cgagaacgtg       180
     aaggccaaga tccaggataa agagggcatc ccccctgacc agcagaggct catctttgcc       240
     ggcaagcagc tggaagatgg ccgcaccctc tctgactaca acatccagaa agagtcaacc       300
     ctgcacctgg tcctccgcct gaggggcggc atgcagatct tcgtgaagac cctgaccggc       360
     aagaccatca ccctggaggt ggagcccagt gacaccatcg agaacgtgaa ggccaagatc       420
     caggataaag agggcatccc ccctgaccag cagaggctca tctttgccgg caagcagctg       480
     gaagatggcc gcaccctctc tgattacaac atccagaaag agtcaaccct gcaccttgtc       540
     ctccgcctga ggggcggcat gcagatcttc gtgaagaccc tgaccggcaa gaccatcacc       600
     ctagaggtgg agcccagtga caccatcgag aacgtgaagg ccaagatcca ggataaagag       660
     ggcatccccc ctgaccagca gaggctcatc tttgccggca agcagctgga agatggccgc       720
     accctctctg attacaacat ccagaaggag tcaaccctgc acctggtcct ccgcctgagg       780
     ggcggcatgc agatcttcgt gaagaccctg accggcaaga ccatcaccct ggaggtggag       840
     cccagtgaca ccatcgagaa cgtgaaggcc aagatccagg ataaagaggg catcccccct       900
     gaccagcaga ggctcatctt tgccggcaag cagctggaag atggccgcac cctctctgat       960
     tacaacatcc agaaagagtc aaccctgcac ctggtcctcc gcctgagggg tggctattaa      1020
     ttcttcagtc tgcattcccg gcgggcactg atggcattac tctgcactct agccatttgc      1080
     cccaatttaa gtttagaaat tacaagtttc agtaatagct gaacctctgt taaaaatgtt      1140
     aataaaggtt ttgttgcatg gtaagcaaca aaaaaaaaaa aaaaaaaaaa aaaaaaaaa       1199
//

If you have problems or comments...

PBIL Back to PBIL home page