(data stored in ACNUC8465 zone)

EMBL: BC060764

ID   BC060764; SV 1; linear; mRNA; STD; HUM; 3841 BP.
XX
AC   BC060764;
XX
DT   05-NOV-2003 (Rel. 77, Created)
DT   15-OCT-2008 (Rel. 97, Last updated, Version 8)
XX
DE   Homo sapiens mitogen-activated protein kinase kinase 4, mRNA (cDNA clone
DE   MGC:71508 IMAGE:5294838), complete cds.
XX
KW   MGC.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-3841
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-3841
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (03-NOV-2003) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; ec159d17b534466a506bbd0a7d81f165.
DR   Ensembl-Gn; ENSG00000065559; homo_sapiens.
DR   Ensembl-Tr; ENST00000353533; homo_sapiens.
DR   Ensembl-Tr; ENST00000415385; homo_sapiens.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Miklos Palkovits, M.D., Ph.D.
CC   cDNA Library Preparation: Michael J. Brownstein (NHGRI) &  Shiraki
CC   Toshiyuki and Piero Carninci (RIKEN)
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: Sequencing Group at the Stanford Human Genome
CC   Center, Stanford University School of Medicine, Stanford, CA  94305
CC   Web site:       http://www-shgc.stanford.edu
CC   Contact:  (Dickson, Mark) mcd@paxil.stanford.edu
CC   Dickson, M., Schmutz, J., Grimwood, J., Rodriquez, A., and Myers,
CC   R. M.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAK Plate: 133 Row: o Column: 9
CC   This clone was selected for full length sequencing because it
CC   passed the following selection criteria: matched mRNA gi: 24497520.
CC   Differences found between this sequence and the human reference
CC   genome (build 36) are described in misc_difference features below
CC   and these differences were also compared to chimpanzee genomic
CC   sequences available as of 09/15/2004.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3841
FT                   /organism="Homo sapiens"
FT                   /lab_host="DH10B"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NIH_MGC_96"
FT                   /clone="MGC:71508 IMAGE:5294838"
FT                   /tissue_type="Brain, hypothalamus"
FT                   /note="Vector: pBluescriptR"
FT                   /db_xref="taxon:9606"
FT   gene            1..3841
FT                   /gene="MAP2K4"
FT                   /note="synonyms: MKK4, MAPKK4, SEK1, JNKK, JNKK1, MEK4,
FT                   PRKMK4"
FT   CDS_pept        64..1263
FT                   /codon_start=1
FT                   /gene="MAP2K4"
FT                   /product="mitogen-activated protein kinase kinase 4"
FT                   /db_xref="GOA:P45985"
FT                   /db_xref="H-InvDB:HIT000260066.14"
FT                   /db_xref="HGNC:HGNC:6844"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="PDB:3ALN"
FT                   /db_xref="PDB:3ALO"
FT                   /db_xref="PDB:3VUT"
FT                   /db_xref="UniProtKB/Swiss-Prot:P45985"
FT                   /protein_id="AAH60764.1"
FT                   /translation="MAAPSPSGGGGSGGGRGSGTPGPVGSPAPGHPAVSSMQGKRKALK
FT                   LNFANPPFKSTARFTLNPNPTGVQNPHIERLRTHSIESSGKLKISPEQHWDFTAEDLKD
FT                   LGEIGRGAYGSVNKMVHKPSGQIMAVKRIRSTVDEKEQKQLLMDLDVVMRSSDCPYIVQ
FT                   FYGALFREGDCWICMELMSTSFDKFYKYVYSVLDDVIPEEILGKITLATVKALNHLKEN
FT                   LKIIHRDIKPSNILLDRSGNIKLCDFGISGQLVDSIAKTRDAGCRPYMAPERIDPSASR
FT                   QGYDVRSDVWSLGITLYELATGRFPYPKWNSVFDQLTQVVKGDPPQLSNSEEREFSPSF
FT                   INFVNLCLTKDESKRLKYKELLKHPFILMYEERAVEVACYVCKILDQMPATPSSPMYVD
FT                   "
FT   misc_difference 109
FT                   /gene="MAP2K4"
FT                   /note="'C' in cDNA is 'A' in the human genome; amino acid
FT                   difference: 'R' in cDNA, 'S' in the human genome. The
FT                   chimpanzee genome agrees with the cDNA sequence, suggesting
FT                   that this difference is unlikely to be due to an artifact."
FT   misc_difference 1130
FT                   /gene="MAP2K4"
FT                   /note="'T' in cDNA is 'C' in the human genome; amino acid
FT                   difference: 'L' in cDNA, 'P' in the human genome. The
FT                   chimpanzee genome agrees with the cDNA sequence, suggesting
FT                   that this difference is unlikely to be due to an artifact."
FT   misc_difference 2591
FT                   /gene="MAP2K4"
FT                   /note="'A' in cDNA is 'G' in the human genome. The
FT                   chimpanzee genome agrees with the human genomic sequence
FT                   and not the cDNA."
FT   misc_difference 3827..3841
FT                   /gene="MAP2K4"
FT                   /note="polyA tail: 15 bases do not align to the human
FT                   genome."
XX
SQ   Sequence 3841 BP; 1133 A; 798 C; 808 G; 1102 T; 0 other;
     gcgagaggcc gagcttgctg cattgcagcc gccgcggcgc cgctcggctc ttcactccca        60
     acaatggcgg ctccgagccc gagcggcggc ggcggctccg ggggcggccg cggcagcggc       120
     acccccggcc ccgtagggtc cccggcgcca ggccacccgg ccgtcagcag catgcagggt       180
     aaacgcaaag cactgaagtt gaattttgca aatccacctt tcaaatctac agcaaggttt       240
     actctgaatc ccaatcctac aggagttcaa aacccacaca tagagagact gagaacacac       300
     agcattgagt catcaggaaa actgaagatc tcccctgaac aacactggga tttcactgca       360
     gaggacttga aagaccttgg agaaattgga cgaggagctt atggttctgt caacaaaatg       420
     gtccacaaac caagtgggca aataatggca gttaaaagaa ttcggtcaac agtggatgaa       480
     aaagaacaaa aacaacttct tatggatttg gatgtagtaa tgcggagtag tgattgccca       540
     tacattgttc agttttatgg tgcactcttc agagagggtg actgttggat ctgtatggaa       600
     ctcatgtcta cctcgtttga taagttttac aaatatgtat atagtgtatt agatgatgtt       660
     attccagaag aaattttagg caaaatcact ttagcaactg tgaaagcact aaaccactta       720
     aaagaaaact tgaaaattat tcacagagat atcaaacctt ccaatattct tctggacaga       780
     agtggaaata ttaagctctg tgacttcggc atcagtggac agcttgtgga ctctattgcc       840
     aagacaagag atgctggctg taggccatac atggcacctg aaagaataga cccaagcgca       900
     tcacgacaag gatatgatgt ccgctctgat gtctggagtt tggggatcac attgtatgag       960
     ttggccacag gccgatttcc ttatccaaag tggaatagtg tatttgatca actaacacaa      1020
     gtcgtgaaag gagatcctcc gcagctgagt aattctgagg aaagggaatt ctccccgagt      1080
     ttcatcaact ttgtcaactt gtgccttacg aaggatgaat ccaaaaggct aaagtataaa      1140
     gagcttctga aacatccctt tattttgatg tatgaagaac gtgccgttga ggtcgcatgc      1200
     tatgtttgta aaatcctgga tcaaatgcca gctactccca gctctcccat gtatgtcgat      1260
     tgatatcgct gctacatcag actctagaaa aaagggctga gaggaagcaa gacgtaaaga      1320
     attttcatcc cgtatcacag tgtttttatt gctcgcccag acaccatgtg caataagatt      1380
     ggtgttcgtt tccatcatgt ctgtatactc ctgtcaccta gaacgtgcat ccttgtaata      1440
     cctgattgat cacacagtgt tagtgctggt cagagagacc tcatcctgct cttttgtgat      1500
     gaacatattc atgaaatgtg gaagtcagta cgatcaagtt gttgactgtg attagatcac      1560
     atcttaaatt catttctaga ctcaaaacct ggagatgcag ctactggaat ggtgttttgt      1620
     cagacttcca aatcctggaa ggacacagtg atgaatgtac tatgtctgaa catagaaact      1680
     cgggcttgag tgagaagagc ttgcacagcc aacgagacac attgccttct ggagctggga      1740
     gacaaaggag gaatttactt tcttcaccaa gtgcaataga ttactgatgt gatattctgt      1800
     tgctttacag ttacagttga tgtttgggga tcgatgtgct cagccaaatt tcctgtttga      1860
     aatatcatgt taaattagaa tgaatttatc tttaccaaaa accatgttgc gttcaaagag      1920
     gtgaacatta aaatatagag acaggacaga atgtgttctt ttctccttta ccagtcctat      1980
     ttttcaatgg gaagactcag gagtctgcca cttgtcaaag aaggtgctga tcctaagaat      2040
     ttttcattct cagaattcgg tgtgctgcca acttgatgtt ccacctgcca caaaccacca      2100
     ggactgaaag aagaaaacag tacagaaggc aaagtttaca gatgttttta attctagtat      2160
     tttatctgga acaacttgta gcagctatat atttcccctt ggtcccaagc ctgatacttt      2220
     agccatcata actcactaac agggagaagt agctagtagc aatgtgcctt gattgattag      2280
     ataaagattt ctagtaggca gcaaaagacc aaatctcagt tgtttgcttc ttgccatcac      2340
     tggtccaggt cttcagtttc cgaatctctt tcccttcccc tgtggtctat tgtcgctatg      2400
     tgacttgcgc ttaatccaat attttgcctt ttttctatat caaaaaacct ttacagttag      2460
     cagggatgtt ccttaccaag gatttttagc cccaaatctc tcatattcgc tagtgtttaa      2520
     aaggctaaga atagtggggc ccagccgatg tggtaggtga taaagaggca tcttttctag      2580
     agacacattg aaccagatga ggatccgaaa cggcagcctt tacgttcatc acctgctaga      2640
     acctctcgta gtccatcacc atttcttggc attggaattc tactggaaaa aaatacaaaa      2700
     agcaaaacaa aaccctcagc actgttacaa gaggccattt aagtatcttg tgcttcttca      2760
     cttacccatt agccaggttc tcattaggtt ttgcttgggc ctccctggca ctgaacctta      2820
     ggctttgtat gacagtgaag cagcactgtg agtggttcaa gcacactgga atataaaaca      2880
     gtcatggcct gagatgcagg tgatgccatt acagaaccaa atcgtggcac gtattgctgt      2940
     gtctcctctc agagtgacag tcataaatac tgtcaaacaa taaagggaga atggtgctgt      3000
     ttaaagtcac atccctgtaa attgcagaat tcaaaagtga ttatctcttt gatctacttg      3060
     cctcatttcc ctatcttctc ccccacggta tcctaaactt tagacttccc actgttctga      3120
     aaggagacat tgctctatgt ctgccttcga ccacagcaag ccatcatcct ccattgctcc      3180
     cggggactca agaggaatct gtttctctgc tgtcaacttc ccatctggct cagcataggg      3240
     tcactttgcc attatgcaaa tggagataaa agcaattctg actgtccagg agctaatctg      3300
     accgttctat tgtgtggatg accacataag aaggcaattt tagtgtatta atcatagatt      3360
     attataaact ataaacttaa gggcaaggag tttattacaa tgtatcttta ttaaaacaaa      3420
     agggtgtata gtgttcacaa actgtgaaaa tagtgtaaga actgtacatt gtgagctctg      3480
     gttatttttc tcttgtacca tagaaaaatg tataaaaatt atcaaaaagc taatgtgcag      3540
     ggatattgcc ttatttgtct gtaaaaaatg gagctcagta acataactgc ttcttggagc      3600
     tttggaatat tttatcctgt attcttgttt gaattcctcc tctatttaag atatatacat      3660
     ggaatcgaag tgtttatgta atagttctat ccttttgcct gcaggtcagt tgtaataaat      3720
     ctaggatgtg atgatgactt tgtaatttga ttttctgaaa tcagaccctg agaggggaaa      3780
     atcttaaagt aaattacatt aaattatctg tgcatttcac accaggaaaa aaaaaaaaaa      3840
     a                                                                      3841
//

If you have problems or comments...

PBIL Back to PBIL home page