(data stored in ACNUC31108 zone)

EMBL: BC060930

ID   BC060930; SV 1; linear; mRNA; STD; VRT; 2005 BP.
XX
AC   BC060930;
XX
DT   05-NOV-2003 (Rel. 77, Created)
DT   21-OCT-2008 (Rel. 97, Last updated, Version 5)
XX
DE   Danio rerio zgc:73292, mRNA (cDNA clone MGC:73292 IMAGE:4787233), complete
DE   cds.
XX
KW   MGC.
XX
OS   Danio rerio (zebrafish)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
OC   Actinopterygii; Neopterygii; Teleostei; Ostariophysi; Cypriniformes;
OC   Cyprinidae; Danio.
XX
RN   [1]
RP   1-2005
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-2005
RA   Strausberg R.;
RT   ;
RL   Submitted (03-NOV-2003) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Cancer
RL   Genomics Office, National Cancer Institute, 31 Center Drive, Room 11A03,
RL   Bethesda, MD 20892-2590, USA
XX
DR   MD5; 09d723ad660dafa4ea9fe652ff3ab945.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Susan E. Brockerhoff, University of Washington
CC   cDNA Library Preparation: Susan E. Brockerhoff, University of
CC   Washington
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: Sequencing Group at the Stanford Human Genome
CC   Center, Stanford University School of Medicine, Stanford, CA  94305
CC   Web site:       http://www-shgc.stanford.edu
CC   Contact:  (Dickson, Mark) mcd@paxil.stanford.edu
CC   Dickson, M., Schmutz, J., Grimwood, J., Rodriquez, A., and Myers,
CC   R. M.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAK Plate: 136 Row: k Column: 7
CC   This clone was selected for full length sequencing because it
CC   passed the following selection criteria: Hexamer frequency ORF
CC   analysis, Similarity but not identity to protein.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2005
FT                   /organism="Danio rerio"
FT                   /lab_host="DH10B"
FT                   /strain="wild-type"
FT                   /mol_type="mRNA"
FT                   /clone_lib="Zebrafish adult retina cDNA"
FT                   /clone="MGC:73292 IMAGE:4787233"
FT                   /tissue_type="Eye, adult retina, 1-2 year old, mixed sex"
FT                   /note="Vector: pBluescript SK-"
FT                   /db_xref="taxon:7955"
FT   gene            1..2005
FT                   /gene="zgc:73292"
FT                   /note="synonyms: fc18f11, fp72a01, wu:fp72a01"
FT   CDS_pept        73..843
FT                   /codon_start=1
FT                   /gene="zgc:73292"
FT                   /product="zgc:73292 protein"
FT                   /db_xref="GOA:Q6P946"
FT                   /db_xref="InterPro:IPR000301"
FT                   /db_xref="InterPro:IPR008952"
FT                   /db_xref="InterPro:IPR018499"
FT                   /db_xref="InterPro:IPR018503"
FT                   /db_xref="UniProtKB/TrEMBL:Q6P946"
FT                   /db_xref="ZFIN:ZDB-GENE-030131-2818"
FT                   /protein_id="AAH60930.1"
FT                   /translation="MGKGCITATKYFLFLFNFIFFIFGATIMGFGLWILLDNQSLIAVL
FT                   QESSVILKVVSYILIGVGSFSMLLGFLGCLGAIYEIRCLLGLYFTCLLLILLAQVALSI
FT                   LIYFQRDLLKTEADKIVSQVVANYPGQNKTAEQAWDYLQRTMQCCGWNGRMDWDENHII
FT                   KNNTVPLYPCSCHNYSIQAPIVPDNGFCQASSSDWPIYQTGCLEHVGSWLFTNYGIILG
FT                   ICLGVAVIELLGMILSMGLCKSVHQEDYTKVPKY"
XX
SQ   Sequence 2005 BP; 552 A; 398 C; 395 G; 660 T; 0 other;
     gacgagacgc gcagctgaca actagtgtac tttctcattt tcccatacta aacgactcta        60
     aacgtcagca aaatggggaa aggatgcata actgcgacca agtacttcct gtttctcttc       120
     aacttcatct tctttatctt cggagccacg attatgggat ttggactgtg gatcctccta       180
     gacaatcaga gtctcattgc agtgttgcag gagtcatccg tgatcctgaa ggtggtctct       240
     tatattctga ttggcgtggg ctccttctcc atgcttctgg ggtttctggg atgtctggga       300
     gccatctatg aaatccgctg cttgcttgga ttgtacttta cctgtctatt gctcattctc       360
     ctggctcaag tggctctgtc cattctcatc tacttccagc gtgatttgtt gaagactgag       420
     gcggataaaa ttgtgtctca agttgtggca aactaccctg gacagaacaa aaccgcagag       480
     caggcctggg actacctgca gagaacaatg cagtgttgtg gctggaatgg acgcatggac       540
     tgggacgaga accatataat aaagaacaat acagtgccgc tgtacccatg ctcctgccac       600
     aattactcca tccaagcacc aattgtacct gataacggct tctgtcaggc ctcttctagt       660
     gattggccca tctatcagac gggctgtctg gagcatgtgg ggagctggct cttcacaaat       720
     tatggaatta ttttgggaat ctgtcttggg gtggctgtca ttgagctgct tggaatgata       780
     ctttctatgg gcctttgcaa gagtgtacac caagaggatt acaccaaagt accgaagtac       840
     tgagaaggaa acacggacac tcatacacaa atgcattcag tccttttttc tttttggaaa       900
     aacagatctc cctctttttt tctacagtat acacagtgtt tccaaatgaa agaaaatgtt       960
     atgtttaatc atgagacttc acccgttgtc agtaacacta tccctgtgat gtctaatgag      1020
     atcttcttag tccattttga atagcccatt gtatgacagt ttgaagtata gcacatgaag      1080
     gctgcacaca taaatgaatg aaacgtgtat gacgagactc gctgcccctg aatgctttat      1140
     ttatacacca aaactcatta acacccattc tagtctgttt gctttgatca tagaggccca      1200
     aactacgagt taacagccaa ttaaacttcg gtttgctctt tatagacaac aggaaaacca      1260
     caaagggcct gcttttgtta aaacaggatt ttactttgat atttagcatt ttgtggtata      1320
     catagactga cacaattccc atccttctgt agtggcatgt ctcaaatacg aaagttgtgt      1380
     tttatagtct gccgtttatg tttgtacatc agtgttgttt caggtttttc ttttattagt      1440
     gtgtatatat tttaggtttc atttgcatgt tcatttggat aagtcttggg agaccttttt      1500
     ttgtacagat gataaattgt atgtcttttt tctacatgcg taaatcgagc ttatttgtat      1560
     gagcacgttt gtaaggaagt acaatatgaa gctattcctc gatgatgtga accaaaatta      1620
     agagattcgc ccccaaagtt gactgcagac ttgatttatt ttgtattgcg ttgatcctaa      1680
     tttaaccgag tttctcctct ggcaccactt tgtctttaat tgtatacttg tttttgacag      1740
     gtataatgga agagttctaa cagtgttttc tttatcatct gtaacaatta ttttgcattt      1800
     gtaaaacttt tagttttgta atataaggta ctcacttatt ttagtgtttt gatgttccaa      1860
     aaacaaatcc tattttttgt aatactggga atacagtccc ctaccaagta attatgaaat      1920
     tattgaagta ttgtaactac atgtaccttt cttaagccga atgtgataca ataaataact      1980
     cacccaaaaa aaaaaaaaaa aaaaa                                            2005
//

If you have problems or comments...

PBIL Back to PBIL home page