(data stored in ACNUC13479 zone)

EMBL: BC061370

ID   BC061370; SV 1; linear; mRNA; STD; VRT; 1659 BP.
XX
AC   BC061370;
XX
DT   05-NOV-2003 (Rel. 77, Created)
DT   16-JUL-2006 (Rel. 88, Last updated, Version 10)
XX
DE   Xenopus tropicalis signal recognition particle receptor, B subunit, mRNA
DE   (cDNA clone MGC:75930 IMAGE:5383790), complete cds.
XX
KW   MGC.
XX
OS   Xenopus tropicalis (tropical clawed frog)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Amphibia;
OC   Batrachia; Anura; Pipoidea; Pipidae; Xenopodinae; Xenopus; Silurana.
XX
RN   [1]
RP   1-1659
RX   DOI; 10.1002/dvdy.10174.
RX   PUBMED; 12454917.
RA   Klein S.L., Strausberg R.L., Wagner L., Pontius J., Clifton S.W.,
RA   Richardson P.;
RT   "Genetic and genomic tools for Xenopus research: The NIH Xenopus
RT   initiative";
RL   Dev. Dyn. 225(4):384-391(2002).
XX
RN   [2]
RP   1-1659
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [3]
RC   NIH-MGC Project
RP   1-1659
RA   Klein S., Gerhard D.S.;
RT   ;
RL   Submitted (03-NOV-2003) to the INSDC.
RL   National Institutes of Health, Xenopus Gene Collection (XGC), National
RL   Institute of Child Health and Human Development, 6100 Executive Boulevard,
RL   Room 4B01, Rockville, MD 20892-7510, USA
XX
DR   MD5; 35a5927d0a380744adfa6bd2dd590f4f.
XX
CC   Contact: XGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Robert M. Grainger
CC   cDNA Library Preparation: Life Technologies, Inc.
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: Sequencing Group at the Stanford Human Genome
CC   Center, Stanford University School of Medicine, Stanford, CA  94305
CC   Web site:       http://www-shgc.stanford.edu
CC   Contact:  (Dickson, Mark) mcd@paxil.stanford.edu
CC   Dickson, M., Schmutz, J., Grimwood, J., Rodriquez, A., and Myers,
CC   R. M.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAK Plate: 143 Row: k Column: 13
CC   This clone was selected for full length sequencing because it
CC   passed the following selection criteria: matched mRNA gi: 45360736.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1659
FT                   /organism="Xenopus tropicalis"
FT                   /lab_host="DH10B"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NICHD_XGC_Emb6"
FT                   /clone="MGC:75930 IMAGE:5383790"
FT                   /tissue_type="Embryo, Silurana tropicalis, neurula (stages
FT                   14-19)"
FT                   /note="Vector: pCMV-SPORT6.1"
FT                   /db_xref="taxon:8364"
FT   gene            1..1659
FT                   /gene="srprb"
FT                   /note="synonym: MGC75930"
FT   CDS_pept        92..841
FT                   /codon_start=1
FT                   /gene="srprb"
FT                   /product="signal recognition particle receptor, B subunit"
FT                   /db_xref="GOA:Q6P860"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR019009"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q6P860"
FT                   /protein_id="AAH61370.1"
FT                   /translation="MEFITQELQKQDPTLLSVGIALIVVVLSFVLWKILRGSRTSRRAV
FT                   LLIGVCDSGKTLLFNRLLTGTYKKTQTSITANCAAYKVKNDKGSSLTLVDLPGHESLRL
FT                   QFLEQYKASARALLFVVDSSAFQREVKEVAELFYQLLTDVAILKNVPPILIACNKQDIS
FT                   MAKSAKLIQQQLEKELNTLRVTRSAAPSILESGNSGVTQLGKKGKDFDFTQLPMKVKFL
FT                   ECSTRDSKEEDGDANISNVEGWLAKLV"
XX
SQ   Sequence 1659 BP; 460 A; 357 C; 383 G; 459 T; 0 other;
     gcaggagtac gcatgcgctg cgcttagtta ctgctacgtg tgaataatgg cggagcctca        60
     ggttcaacat gattctcggt ggttgccgga catggagttc attacgcagg agctgcagaa       120
     gcaagacccg accttgctct ccgtggggat cgccctaatt gttgtcgtgc ttagctttgt       180
     tctatggaag attctgcgag gcagtcggac cagccgcaga gcagtgctgc ttattggagt       240
     gtgtgactcg ggaaaaactc tactgttcaa caggttactt acaggaacat acaagaaaac       300
     ccaaacctcc atcactgcca attgtgctgc atataaagtg aagaatgaca agggttccag       360
     tttgacgctt gttgacctcc ctggccatga aagtttgagg cttcagttcc tggagcaata       420
     taaagcatca gcaagggcat tgctgtttgt agtggacagt tccgcgttcc agcgtgaggt       480
     gaaggaggtg gcagagcttt tttaccaact tttgacagat gttgcaatac tgaaaaatgt       540
     gccaccaata cttattgcgt gcaataagca agatatttca atggccaaat ctgccaaact       600
     tatacagcag cagctggaga aagagctgaa cactcttcgt gtcacccgct cagctgcccc       660
     tagcatcttg gagagtggaa actctggcgt cacgcagctt gggaagaaag gcaaagactt       720
     tgattttacc cagttgccta tgaaggtaaa attcctggaa tgcagcactc gggacagtaa       780
     agaagaggac ggtgatgcca atatcagtaa tgttgagggc tggctggcga agctggtttg       840
     agaaactttt cccaagttgt acaaggacac aggcgctaag atgatgaaac attgaatgga       900
     tttttctgca tcttgactcg taagggaaac ccttatttgg ttggtgcctt gttcatgact       960
     gctgcattgg tgaggctgcc gctttcttac tatgctttag acaaaagaaa cgtgcagctc      1020
     tgaggaaaca gtgtctattt tgtcagctct tgtactccat gtcacttgaa caataaccaa      1080
     aatgtaatga attccttaca tgctggattt ccacctccca ttctgtgctg agggaatggt      1140
     taatgcagag caacctgtat ttctccagcc tttgtctagc tacaacttcc actgtaccat      1200
     ttacagcctt tggcatggac gttaggtaca tgtttagaca tctggaggac cacaggttgt      1260
     gttgtgccac caaccagtgg ctcaggggca acatgttgct caccaacccc ttggatcttg      1320
     cgctcagtgc ccccaaacca ggtagttatt tttgaattcc tgacttagtg gcaagttttg      1380
     gtttaataaa aacaagattt actcccaaat aaagcctcct gtaagctgat agagactgcc      1440
     taatagccaa tcttagccct tatttggcac cttcatgaac ttttataatg ctttagttgc      1500
     tctccaagtc tttttacatt tggctgttac tcactagtaa gaaaggctgg gaacccctgc      1560
     tctagggaca tatatttatt ttgaatttga actttcaaat aaatcagtat taaagtggaa      1620
     gttcaccttc aaaaaaaaaa aaaaaaaaaa aaaaaaaaa                             1659
//

If you have problems or comments...

PBIL Back to PBIL home page