(data stored in ACNUC3759 zone)

EMBL: BC061745

ID   BC061745; SV 1; linear; mRNA; STD; ROD; 3235 BP.
XX
AC   BC061745;
XX
DT   07-NOV-2003 (Rel. 77, Created)
DT   16-JUL-2006 (Rel. 88, Last updated, Version 5)
XX
DE   Rattus norvegicus GATA binding protein 2, mRNA (cDNA clone MGC:72369
DE   IMAGE:5599740), complete cds.
XX
KW   MGC.
XX
OS   Rattus norvegicus (Norway rat)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Rattus.
XX
RN   [1]
RP   1-3235
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-3235
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (05-NOV-2003) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; 3a6dc3b88c405e20efa3c1e024a65514.
DR   Ensembl-Gn; ENSRNOG00000012347; rattus_norvegicus.
DR   Ensembl-Tr; ENSRNOT00000017240; rattus_norvegicus.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Jeff Green/Paturu Kondaiah, NCI.
CC   cDNA Library Preparation: Life Technologies, Inc.
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: National Institutes of Health Intramural
CC   Sequencing Center (NISC),
CC   Gaithersburg, Maryland;
CC   Web site: http://www.nisc.nih.gov/
CC   Contact: nisc_mgc@nhgri.nih.gov
CC   Akhter,N., Ayele,K., Beckstrom-Sternberg,S.M., Benjamin,B.,
CC   Blakesley,R.W., Bouffard,G.G., Breen,K., Brinkley,C., Brooks,S.,
CC   Dietrich,N.L., Granite,S., Guan,X., Gupta,J., Haghighi,P.,
CC   Hansen,N., Ho,S.-L., Karlins,E., Kwong,P., Laric,P., Legaspi,R.,
CC   Maduro,Q.L., Masiello,C., Maskeri,B., Mastrian,S.D.,McCloskey,J.C.,
CC   McDowell,J., Pearson,R., Stantripop,S., Thomas,P.J., Touchman,J.W.,
CC   Tsurgeon,C., Vogt,J.L., Walker,M.A., Wetherby,K.D., Wiggins,L.,
CC   Young,A., Zhang,L.-H. and Green,E.D.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAK Plate: 137 Row: g Column: 17
CC   This clone was selected for full length sequencing because it
CC   passed the following selection criteria: matched mRNA gi: 15559216.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3235
FT                   /organism="Rattus norvegicus"
FT                   /lab_host="DH10B"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NCI_CGAP_Pr50"
FT                   /clone="MGC:72369 IMAGE:5599740"
FT                   /tissue_type="Prostate, pool of NCI_CGAP_Pr30, 40, 41 and
FT                   NCI_CGAP_Pr29, 39, 42"
FT                   /note="Vector: pCMV-SPORT6.1"
FT                   /db_xref="taxon:10116"
FT   gene            1..3235
FT                   /gene="Gata2"
FT   CDS_pept        251..1693
FT                   /codon_start=1
FT                   /gene="Gata2"
FT                   /product="GATA binding protein 2"
FT                   /db_xref="GOA:Q924Y4"
FT                   /db_xref="InterPro:IPR000679"
FT                   /db_xref="InterPro:IPR013088"
FT                   /db_xref="InterPro:IPR016374"
FT                   /db_xref="InterPro:IPR029522"
FT                   /db_xref="InterPro:IPR039355"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q924Y4"
FT                   /protein_id="AAH61745.1"
FT                   /translation="MEVAPEQPRWMAHPAVLNAQHPDSHHPGLAHNYMEPAQLLPPDEV
FT                   DVFFNHLDSQGNPYYANPAHARARVSYSPAHARLTGGQMCRPHLLHSPGLPWLDGGKAA
FT                   LSAAAAHHHSPWTVSPFSKTPLHPSAAGAPGGPLSVYPGAAGGSGGGSGSSVASLTPTA
FT                   AHSGSHLFGFPPTPPKEVSPDPSTTGAASPASPSAGGSVARGEDKDGVKYQVSLSESMK
FT                   MEGGSPLRPGLAPMGTQPATHHPIPTYPSYVPASAHEYGSGLFHPGGFLGGPASSFTPK
FT                   QRSKARSCSEGRECVNCGATATPLWRRDGTGHYLCNACGLYHKMNGQNRPLIKPKRRLS
FT                   AARRAGTCCANCQTTTTTLWRRNANGDPVCNACGLYYKLHNVNRPLTMKKEGIQTRNRK
FT                   MSSKSKKSKKGAECFEELSKCMQEKSSPFSAAALAGHMAPVGHLPPFSHSGHILPTPTP
FT                   IHPSSSLSFGHPHPSSMVTAMG"
XX
SQ   Sequence 3235 BP; 724 A; 969 C; 860 G; 682 T; 0 other;
     gtcggcagct ggcgccaggg cggccggagg atgcagaggg gccggagccg ggcgggccgg        60
     aggccgagac gcgcgctgtc ccccacctct atcccgtgaa tccgccagcc ttgggacgcg       120
     ctgtcgctgg gcccgccgta cccgggctct cctggtgtcc cttactctct actgctgagc       180
     cctccccttc ccgcgccgct gcgagtggtc gccccacctt cgcctggatc ccaagccgca       240
     gtagtggacc atggaggtgg cgcctgagca gcctcgctgg atggcgcacc ccgccgtatt       300
     gaatgcgcag caccccgact cgcaccatcc gggcctggca cacaactaca tggagccggc       360
     acagctgctg cctccggacg aggtggatgt cttcttcaac cacctcgact cgcagggcaa       420
     cccctactac gccaacccag cccacgcgcg cgcgcgcgtt tcctacagtc cagcgcatgc       480
     ccgtctcaca ggaggccaga tgtgccgacc acacttgttg cacagcccag gcttgccatg       540
     gctggacggg ggcaaagcag ctctctctgc cgctgctgcc catcaccaca gcccctggac       600
     cgtcagcccg ttctccaaga ccccgctgca cccctcagct gctggagcac ctggagggcc       660
     tctgtctgtg tacccagggg ctgcgggtgg gagcggtgga ggcagcggga gctccgtagc       720
     ctccctcacc cccactgcag cccactcagg ctcccatctc ttcggcttcc cacccacgcc       780
     acccaaagaa gtgtctccag accccagcac cacaggagct gcttccccag cctcaccttc       840
     agcagggggt agtgtagccc ggggtgagga caaggatggc gtcaagtatc aagtgtcact       900
     gtctgagagc atgaagatgg aaggtggcag tcccctgcgc ccgggcctag ctcccatggg       960
     cacccagcct gcaacacacc acccaatacc cacctatccc tcctatgtgc ctgcctcagc      1020
     tcatgaatat ggcagcgggc tcttccatcc cggaggcttc ctgggtggcc cagcctccag      1080
     cttcacccct aagcagcgaa gcaaggctcg ctcctgctca gaaggccggg agtgtgtcaa      1140
     ctgcggggcc acagccaccc ctctctggcg acgggatggc acgggccact acctgtgcaa      1200
     tgcctgtggg ctctaccaca agatgaatgg acagaatcgg ccgctcatca agcccaagag      1260
     gagactgtct gctgccagga gagcgggcac ctgttgtgca aattgtcaga cgacaaccac      1320
     caccttatgg cgccggaacg ccaacgggga ccctgtgtgc aacgcctgtg gcctctacta      1380
     caagctgcac aatgttaaca ggccactgac catgaagaag gaagggatcc agacccggaa      1440
     tcggaagatg tccagcaaat ccaagaagag caagaaagga gccgaatgct ttgaggagct      1500
     atccaagtgc atgcaggaga agtcatcccc cttcagtgcg gctgccctgg ctggacacat      1560
     ggcacctgtg ggacacctcc caccttttag tcactctgga cacatcctac ctacgccaac      1620
     gcctatccac ccctcctcca gtctctcctt tggtcacccc cacccgtcca gcatggtgac      1680
     tgccatgggc taggcacagc ctccggctgg acagacatgg acatcaaggg tggttggcag      1740
     aaccagagcg aggctgggca ctccccggat gggtggaacg tactcttggc tcctgcccat      1800
     cccaagagac ccacttcctc ctgccagcct agtctggctg aagccacctc tccttggagg      1860
     actcccagcc ttgtgccgcc attactgtga atatttctaa gtgggctgca gcttgtgtgt      1920
     gccctgggtg ctgcccagaa gtgttttcac ggacagtgtt tgtttggaga gcaaaatgga      1980
     caggtttaca gatttatagc aagaggagga gactagggat agaaaaatga aacttttttt      2040
     tctttttttt ttttttgaag gagaaaggag taggcaaaaa aatatttatt ttgctcttat      2100
     ttcttacaag aacgtgaaga cacagaggca tgggctgttt gtgttctctg ggtccttcct      2160
     tgggacctac tgccaccagt cagggctctt gggggcagct tacaggtcct caggctgagc      2220
     ctgctcctcc ccagcctgcc gggagggtag cccttgccct gacgcagccc cagagggcag      2280
     agacaattgc aggcggtcct gtgcggattc ccaggccagg gctgggtcac aggaaggaag      2340
     cattctctgg aaaggggaaa tgtctcccag atcattcccc tggcttccag aggccaaaac      2400
     tggtgtgacc caaatgggcc aagctgtagc ctgtgctcta ggccagttgg acccctgtaa      2460
     atacatcctt ttttttctgc taaacccctc aaccccctcc cactctaaga taaataagaa      2520
     aatactcaaa tcaaaaacca aactgcataa gcttaacccg ctgatgagtg gttttacttt      2580
     gaaactcgtt ttgggtccag tccgttgtac gtcgccacag aagccacacc atgaaaaaga      2640
     ataaaacctt aaaaaacaaa acaaaacaaa acaaaaccag ggccaagctt cacagttctt      2700
     taaatggttc ttgggttcca cggccctagc aggagactgg ggacaagggg caatcttctg      2760
     ctcttggttt ctggggggac agggcgtggg caggcagtgg ccctgtggtc ccaggcttct      2820
     gttctgcggt agccggctgg atccttcaag gtacagctgt acataaaaat gtgtcccaag      2880
     cttcgattct gtgtgcggtg gtggcagtgg tgcagcagcc ggcacggggc cccgagccca      2940
     gggagacgat tgtgcggact agtcaaccaa gtgcaatatc ggtgcccact gctgcagagc      3000
     gccccaacag aaagtaactt attttgtgct agtacccgcc taagaaaaga atcggcagta      3060
     ttttctgttt ttatgttttg ggcttgtttt attttggatt agtgacctaa gttattgtta      3120
     actgtgtaca acatttaaat attgtctgta aaaattgtat gctaccctct tattccttta      3180
     aagtgaatac tgttaaaagt aataaaatac tttttgtgaa aaaaaaaaaa aaaaa           3235
//

If you have problems or comments...

PBIL Back to PBIL home page