(data stored in ACNUC22857 zone)

EMBL: BC063350

ID   BC063350; SV 1; linear; mRNA; STD; VRT; 3913 BP.
XX
AC   BC063350;
XX
DT   04-DEC-2003 (Rel. 78, Created)
DT   21-JUL-2006 (Rel. 88, Last updated, Version 10)
XX
DE   Xenopus tropicalis adaptor-related protein complex 2, beta 1 subunit, mRNA
DE   (cDNA clone MGC:75877 IMAGE:5383070), complete cds.
XX
KW   MGC.
XX
OS   Xenopus tropicalis (tropical clawed frog)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Amphibia;
OC   Batrachia; Anura; Pipoidea; Pipidae; Xenopodinae; Xenopus; Silurana.
XX
RN   [1]
RP   1-3913
RX   DOI; 10.1002/dvdy.10174.
RX   PUBMED; 12454917.
RA   Klein S.L., Strausberg R.L., Wagner L., Pontius J., Clifton S.W.,
RA   Richardson P.;
RT   "Genetic and genomic tools for Xenopus research: The NIH Xenopus
RT   initiative";
RL   Dev. Dyn. 225(4):384-391(2002).
XX
RN   [2]
RP   1-3913
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [3]
RC   NIH-MGC Project
RP   1-3913
RA   Klein S., Gerhard D.S.;
RT   ;
RL   Submitted (02-DEC-2003) to the INSDC.
RL   National Institutes of Health, Xenopus Gene Collection (XGC), National
RL   Institute of Child Health and Human Development, 6100 Executive Boulevard,
RL   Room 4B01, Rockville, MD 20892-7510, USA
XX
DR   MD5; 5914ced63d5b8cfc34ad27787cc2de8b.
XX
CC   Contact: XGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Robert M. Grainger
CC   cDNA Library Preparation: Life Technologies, Inc.
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: Sequencing Group at the Stanford Human Genome
CC   Center, Stanford University School of Medicine, Stanford, CA  94305
CC   Web site:       http://www-shgc.stanford.edu
CC   Contact:  (Dickson, Mark) mcd@paxil.stanford.edu
CC   Dickson, M., Schmutz, J., Grimwood, J., Rodriquez, A., and Myers,
CC   R. M.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAK Plate: 143 Row: i Column: 4
CC   This clone was selected for full length sequencing because it
CC   passed the following selection criteria: matched mRNA gi: 45361256.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3913
FT                   /organism="Xenopus tropicalis"
FT                   /lab_host="DH10B"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NICHD_XGC_Emb6"
FT                   /clone="MGC:75877 IMAGE:5383070"
FT                   /tissue_type="Embryo, Silurana tropicalis, neurula (stages
FT                   14-19)"
FT                   /note="Vector: pCMV-SPORT6.1"
FT                   /db_xref="taxon:8364"
FT   gene            1..3913
FT                   /gene="ap2b1"
FT                   /note="synonym: MGC75877"
FT   CDS_pept        218..3073
FT                   /codon_start=1
FT                   /gene="ap2b1"
FT                   /product="adaptor-related protein complex 2, beta 1
FT                   subunit"
FT                   /db_xref="GOA:Q6P4L7"
FT                   /db_xref="InterPro:IPR000225"
FT                   /db_xref="InterPro:IPR002553"
FT                   /db_xref="InterPro:IPR008152"
FT                   /db_xref="InterPro:IPR009028"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR012295"
FT                   /db_xref="InterPro:IPR013037"
FT                   /db_xref="InterPro:IPR013041"
FT                   /db_xref="InterPro:IPR015151"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR016342"
FT                   /db_xref="InterPro:IPR026739"
FT                   /db_xref="UniProtKB/TrEMBL:Q6P4L7"
FT                   /protein_id="AAH63350.1"
FT                   /translation="MTDSKYFTTNKKGEIFELKAELNNEKKEKRKEAVKKVIAAMTVGK
FT                   DVSSLFPDVVNCMQTDNLELKKLVYLYLMNYAKSQPDMAIMAVNSFVKDCEDPNPLIRA
FT                   LAVRTMGCIRVDKITEYLCEPLRKCLKDEDPYVRKTAAVCVAKLHDINAQMVEDQGFLD
FT                   SLRDLIADSNPMVVANAVAALSEISESHPNSNLLDLNPQNINKLLTALNECTEWGQIFI
FT                   LDCLSNYNPKDEREAQSICERVTPRLSHANSAVVLSAVKVLMKFLELLPKDSDYYTMLL
FT                   KKLAPPLVTLLSGEPEVQYVALRNINLIVQKRPEILKQEIKVFFVKYNDPIYVKLEKLD
FT                   IMIRLASQANIAQVLAELKEYATEVDVDFVRKAVRAIGRCAIKVEQSAERCVSTLLDLI
FT                   QTKVNYVVQEAIVVIRDIFRKYPNKYESIIATLCENLDSLDEPDARGAMIWIVGEYAER
FT                   IDNADELLESFLEGFHDESTQVQLTLLTAIVKLFLKKPSETQELVQQVLSLATQDSDNP
FT                   DLRDRGYIYWRLLSTDPVTAKEVVLSEKPLISEETDLIEPTLLDELICHIGSLASVYHK
FT                   PPNAFVEGSHGVHRKHLPIQHGSIDIGDSPVGPTPSAGLEQPQVIPSQGDLLGDLLNLD
FT                   LGPPGNVPQVSTMQMGAVDLLGGGLDSLLGSDLGGGIGGSPAVGQTFIPSSVPATFAPS
FT                   PTPAVVSSGLNDLFELSSGIGMAPGGYVSQKAVWLPAVKAKGLEISGTFSHRQAHIYMD
FT                   MSFTNKALQHMTDFAIQFNKNSFGVIPSAPLAIHTPLMPNQSIDISLPLNTLGPVMKME
FT                   PLNNLQVAVKNNIDVFYFSCLIPLHVLFVEDGKMERQVFLATWKDIPNENELQFQIKDC
FT                   HLNADTVSSKLQNNNVYTIAKRNVEGQDMLYQSLKLTNGIWILAELRIQPGNPNYTLSL
FT                   KCRAPEVCNYVYQVYDSILKN"
XX
SQ   Sequence 3913 BP; 1076 A; 859 C; 872 G; 1106 T; 0 other;
     ttattccggt tgttgagacg cctttcgcat ttccggtgta tggaacgcag atggtagtag        60
     ctgtgtgtga gagctgtgct agatttccgg ggcagcgacc cgcacagcgc cttctcctct       120
     ccctgggttt ctcttcattc ggacatttat ctctctcgtt cctaagcaag tctgtatttt       180
     tctgtacgtt atcgtgtaat cgaagttgaa aagaaacatg acggattcaa agtattttac       240
     aactaacaaa aaaggggaga tctttgagct gaaagctgaa cttaacaatg agaagaaaga       300
     gaaacggaag gaagctgtga agaaggttat tgctgcaatg accgtgggca aagatgtcag       360
     ctccctgttt ccagatgtgg tgaactgcat gcaaacagac aatctggaac tgaagaaact       420
     tgtttacctt tacctgatga actatgctaa aagccaacca gacatggcaa tcatggctgt       480
     taacagcttt gtcaaggact gtgaggatcc aaaccctctg atccgagccc tggcagtgcg       540
     taccatgggt tgtatccgag ttgataaaat cacagagtac ctttgtgagc ctttgcggaa       600
     gtgcctgaag gatgaggacc catacgtgcg caagacagca gcagtgtgtg tggccaaact       660
     ccatgatatc aatgcccaga tggtggaaga tcagggcttc ttagattcac tgagggatct       720
     gattgctgat tccaacccaa tggtggtagc caatgcagta gctgcactgt cagagatcag       780
     cgagtcacac ccaaacagta atctgttgga cctgaatccc cagaacatca acaaactgct       840
     gactgctctg aatgaatgca ctgagtgggg ccagatcttc atcttggact gtttatctaa       900
     ttataatcct aaggatgaga gggaggcgca gagtatctgt gaacgtgtca ctcctcggtt       960
     gtctcatgcc aactctgctg tggtgctgtc tgctgtcaaa gtcttaatga aattcctaga      1020
     gttgctgcct aaagactctg attactatac tatgctgttg aaaaaactgg ctcccccttt      1080
     ggttactttg ctgtctggcg agcctgaggt gcagtatgta gcacttcgga acatcaacct      1140
     tattgtacag aaaagacctg aaattctaaa acaagaaatt aaagttttct ttgtaaagta      1200
     caatgatccg atttatgtca aactggagaa actggatata atgattcgcc tggcatcaca      1260
     ggctaacatt gctcaggtct tggctgagct gaaggaatat gccacagagg tggatgttga      1320
     ttttgttaga aaggctgttc gtgccatagg acgctgtgcc attaaagttg agcaatctgc      1380
     agagcgctgt gtgagcactc tcttggacct catccagacc aaggttaact acgttgttca      1440
     agaagccatt gttgtcatca gagacatctt ccgcaagtat cctaacaagt atgaaagtat      1500
     aattgccaca ctgtgtgaga atctggattc cttggatgag ccagatgccc gtggtgccat      1560
     gatctggatt gttggtgaat atgcagaacg tattgacaat gctgatgaac tactggagag      1620
     cttcttggag ggatttcacg atgagagtac acaggttcaa cttactctac ttacggctat      1680
     tgtcaaactc tttctgaaga agccatcaga aacccaagag ctggttcaac aagttctcag      1740
     cctggctaca caggattctg ataacccaga cctgcgagac agaggctata tttactggcg      1800
     attgctctct actgatccag taactgccaa agaagttgtg ctttcagaga agccactgat      1860
     atctgaagag acagacctaa ttgaacccac tcttctggat gaattaattt gccatattgg      1920
     ctcactggcg tcggtctacc acaagccacc taacgccttt gtggaaggga gtcatggagt      1980
     gcatcgcaag caccttccaa ttcagcatgg aagcattgat attggagaca gccctgttgg      2040
     tcccactcca tctgctgggc tcgaacagcc ccaggttatt ccatcacaag gtgacctcct      2100
     tggagatctt cttaatctcg atctgggccc tccaggaaat gtgccacaag tgtccaccat      2160
     gcagatggga gcagtggacc ttcttggtgg aggtctggat agcttgctgg gaagtgacct      2220
     tggtggcggc attggtggga gtccagcggt tgggcaaacc ttcattccct cctccgttcc      2280
     agcaacattt gctccgtccc ctacaccagc ggtggttagc agtggactga atgatttgtt      2340
     tgaactgtct tctggtattg ggatggcgcc tggaggatat gtatcacaaa aagctgtctg      2400
     gttacctgct gtaaaagcca aaggcttgga gatctctggt acattctccc acaggcaagc      2460
     acacatctac atggatatga gtttcaccaa caaagctttg cagcacatga ctgactttgc      2520
     aatacagttt aataagaaca gctttggtgt cattcccagt gcccctctgg cgattcatac      2580
     tcccctcatg cccaaccaaa gtattgacat ttctcttcct ctaaacaccc ttgggcctgt      2640
     tatgaaaatg gagcccctta acaatctcca ggtggctgtg aaaaataaca tcgacgtgtt      2700
     ctacttcagt tgtcttatcc ctctacatgt gctctttgtg gaggatggca aaatggaacg      2760
     tcaagtcttc ctggccacat ggaaggacat ccccaatgag aatgagctgc agtttcagat      2820
     caaagattgc catttgaatg cagacacagt ttccagcaag cttcagaata acaatgttta      2880
     taccattgcc aagcggaatg tggaagggca ggacatgctg taccaatccc tcaaacttac      2940
     caatggtatc tggattctag cagagctgag gatccagcct ggaaatccca attatacgct      3000
     ttccttgaag tgccgtgcac cagaggtctg taactatgtt taccaagtgt atgactctat      3060
     actgaagaac tgaatgcgaa actcctcaaa tgaacctggt cctacatata cactaactct      3120
     gtctctatgt aatctgactc agctatacca atgacttctt attttttgtt ggaaaatgca      3180
     gtccatggct gtttcaacag gaaaccagcc tttaacatct tgatttttgg accatttcaa      3240
     gcacttctga tttagttatc tattggtctc caatgtgacg tgggtccact taacttttaa      3300
     tgctatgaga tgattaagcc tgtttgggtt attgttagac acctatcaac tgcagcccat      3360
     caactgtatt cattaagatt ggaaatccaa cattattcag gtgtttgtct tgtatcccat      3420
     ttagctgact gcacaatggg taaatgattt attccgcagt gctagatgtt tcctgaccaa      3480
     gacatttcca tatgacccag gttaagaacc agttattgtg attgtgtgga gttgcttaat      3540
     gtattatact ggacgcagta gtagctaata gctcccttta cctgatgtta gatgaaatgt      3600
     tatatgcaaa ttggttccaa cctttttaat tagcctaacc acatattatg taagtacata      3660
     gtgtctatct tgtaacttag tcacttttta gaacttggta aacgtaagca gtctttacat      3720
     gtgtttgtgc cacttatata cccacctctt ctgtgacact gcttctcagc attgccatgc      3780
     atacatttac attccgtgcc aatgctgaag gtattccgag ctgaataaat atgttatatg      3840
     tgtattgtaa gcaaagaaaa agatccaata aaacggaata tgtttcagga aaaaaaacaa      3900
     aaaaaaaaaa aaa                                                         3913
//

If you have problems or comments...

PBIL Back to PBIL home page