(data stored in ACNUC9435 zone)

EMBL: BC063656

ID   BC063656; SV 1; linear; mRNA; STD; HUM; 1990 BP.
XX
AC   BC063656;
XX
DT   13-DEC-2003 (Rel. 78, Created)
DT   15-OCT-2008 (Rel. 97, Last updated, Version 5)
XX
DE   Homo sapiens SET binding factor 2, mRNA (cDNA clone IMAGE:5123552), partial
DE   cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1990
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-1990
RA   Director MGC Project;
RT   ;
RL   Submitted (08-DEC-2003) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Cancer
RL   Genomics Office, National Cancer Institute, 31 Center Drive, Room 11A03,
RL   Bethesda, MD 20892-2590, USA
XX
DR   MD5; ec185db768da5d62c6c463831ac05537.
DR   Ensembl-Gn; ENSG00000133812; homo_sapiens.
DR   Ensembl-Tr; ENST00000256190; homo_sapiens.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: ATCC
CC   cDNA Library Preparation: Life Technologies, Inc.
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: National Institutes of Health Intramural
CC   Sequencing Center (NISC),
CC   Gaithersburg, Maryland;
CC   Web site: http://www.nisc.nih.gov/
CC   Contact: nisc_mgc@nhgri.nih.gov
CC   Akhter,N., Ayele,K., Beckstrom-Sternberg,S.M., Benjamin,B.,
CC   Blakesley,R.W., Bouffard,G.G., Breen,K., Brinkley,C., Brooks,S.,
CC   Dietrich,N.L., Granite,S., Guan,X., Gupta,J., Haghighi,P.,
CC   Hansen,N., Ho,S.-L., Karlins,E., Kwong,P., Laric,P., Legaspi,R.,
CC   Maduro,Q.L., Masiello,C., Maskeri,B., Mastrian,S.D.,McCloskey,J.C.,
CC   McDowell,J., Pearson,R., Stantripop,S., Thomas,P.J., Touchman,J.W.,
CC   Tsurgeon,C., Vogt,J.L., Walker,M.A., Wetherby,K.D., Wiggins,L.,
CC   Young,A., Zhang,L.-H. and Green,E.D.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAK Plate: 134 Row: p Column: 3
CC   This clone was selected for full length sequencing because it
CC   passed the following selection criteria: GenomeScan gene
CC   prediction.
CC   Differences found between this sequence and the human genome (build
CC   35) are described in misc_difference features below.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1990
FT                   /organism="Homo sapiens"
FT                   /lab_host="DH10B"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NIH_MGC_12"
FT                   /clone="IMAGE:5123552"
FT                   /tissue_type="Cervix, carcinoma"
FT                   /note="Vector: pCMV-SPORT6"
FT                   /db_xref="taxon:9606"
FT   gene            <1..1990
FT                   /gene="SBF2"
FT                   /note="synonyms: MTMR13, KIAA1766, CMT4B2"
FT   CDS_pept        <1..695
FT                   /codon_start=3
FT                   /gene="SBF2"
FT                   /product="SBF2 protein"
FT                   /db_xref="GOA:Q86WG5"
FT                   /db_xref="H-InvDB:HIT000261110.12"
FT                   /db_xref="HGNC:HGNC:2135"
FT                   /db_xref="InterPro:IPR001194"
FT                   /db_xref="InterPro:IPR001849"
FT                   /db_xref="InterPro:IPR004182"
FT                   /db_xref="InterPro:IPR005112"
FT                   /db_xref="InterPro:IPR005113"
FT                   /db_xref="InterPro:IPR010569"
FT                   /db_xref="InterPro:IPR011993"
FT                   /db_xref="InterPro:IPR022096"
FT                   /db_xref="InterPro:IPR029021"
FT                   /db_xref="InterPro:IPR030564"
FT                   /db_xref="InterPro:IPR030567"
FT                   /db_xref="InterPro:IPR037516"
FT                   /db_xref="InterPro:IPR037823"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q86WG5"
FT                   /protein_id="AAH63656.1"
FT                   /translation="QRRTVWPCYDDVSCTQPDALTSLFSEIEKLEHKLNQAPEKWQQLW
FT                   ERVTVDLKEEPRTDRSQRHLSRSPGIVSTNLPSYQKRSLLHLPDSSMGEEQNSSISPSN
FT                   GVERRAATLYSQYTSKNDENRSFEGTLYKRGALLKGWKPRWFVLDVTKHQLRYYDSGED
FT                   TSCKGHIDLAEVEMVIPAGPSMGAPKHTSDKAFFDLKTSKRVYNFCAQDGQSAQQWMDK
FT                   IQSCISDA"
FT   misc_difference 735
FT                   /gene="SBF2"
FT                   /note="'C' in cDNA is 'A' in the human genome."
FT   misc_difference 1960..1990
FT                   /gene="SBF2"
FT                   /note="polyA tail: 31 bases do not align to the human
FT                   genome."
XX
SQ   Sequence 1990 BP; 616 A; 449 C; 419 G; 506 T; 0 other;
     gccagaggag aacagtgtgg ccatgctatg atgatgtcag ctgtactcag cctgatgctc        60
     tcaccagcct tttcagtgaa attgaaaaat tggagcacaa attgaaccaa gcccctgaga       120
     agtggcagca gctgtgggaa agggtaaccg tggaccttaa agaagaacca agaacagatc       180
     gctcccaaag acacctgtcg agatccccag gaattgtgtc taccaaccta ccttcctatc       240
     agaagaggtc tctgctacat ctcccagaca gcagcatggg ggaggaacag aattccagca       300
     tctccccatc caatggagtg gagcgaagag cagccacgct ctatagccag tatacatcca       360
     agaatgatga aaacaggtcc tttgagggaa cactttataa aagaggggct ttgctgaaag       420
     gttggaagcc ccgttggttt gttttggatg taacaaaaca tcagctgcgc tactatgact       480
     caggtgagga cacaagctgt aaaggccaca ttgatctggc tgaagtagaa atggtcatcc       540
     ctgctggccc cagcatggga gccccaaagc acacaagtga caaggctttc tttgatctca       600
     agaccagcaa acgtgtgtat aacttctgcg cccaggatgg acagagtgcc cagcaatgga       660
     tggacaagat ccagagttgt atctctgatg cctgatgccc atggtcaacc cacgcagaag       720
     aaacagaaga actcctgctg ccagatagat agaaaaagaa gcatggatcc ttgaggagct       780
     gacaacaagt tatcccaggg cctgaggttc tcctgcccag tcccctcttg caggggttgc       840
     tatatctact taacctgaat aggtgtttca cacaggtctg gtcaacagcc ccatgcactc       900
     cctgtatctt gcactaaatt tttctaacag ggtcttagtg gttaatgatc agaagatgtc       960
     tcctgagcca actgtgaacc tcacccaggc aaaatggcta ccacctactt gggtccttct      1020
     tcatgaaagc tatagatcct tttttgttct ctgaggtcat aatttcctcg gagacctgtt      1080
     taacaagcaa aaatcaaaac cctccaagat tgtctcatat tctacctgga ctaggtttcc      1140
     tatgagagac atctacttgt aatgcctgac ctttgagatg ctcagttctc tggtgctgcc      1200
     aaaagatgct tccatggtcc gtgctctgcc agtggggttc acaacaagag acgtcattgt      1260
     tcagtagcag gcaaagaggg agcacacagc attattctga tggaaaaaga ttatccaggg      1320
     aatggtacaa caatgaccag cccaatgcag gaaaacacta cttccaaaac actgaattct      1380
     ctagaccaga ggtgctctga ggatccaggg ccttgtgttc ttatgtatct tctgcttcct      1440
     gacagcttct ttttcaaaat aacatgcaaa aaaagctgaa tgcactaact cacaaaacaa      1500
     acacttgcac tgaattccca atgaagtgaa gatgttggaa agacagaggc cagctattta      1560
     ggaccatacg cacctgtgac aagggctgtg ttgaccacag tcacactgtg gcatgactgg      1620
     atacccaaac tacacttcta cacatgaaaa gtaagaactg tctttagatt ttctttactt      1680
     tgataacttg tgattgttta gcttaagacc caagaaatgc tgtttgctca tggtaaacag      1740
     aaacagcatc ttcgctacaa ccactgacac cagctggcgt cataggtagc tagatcattg      1800
     catttgtttt gaaatgttaa tatgttaaat actaaactaa tatttcaaaa atgtgtatat      1860
     atgatttcta tatccttgtt tttcagatag cctgcttata atttaatata aattaactga      1920
     tgcattcata agatttcaat aatgaaatgg ttccctttta aaaaaaaaaa aaaaaaaaaa      1980
     aaaaaaaaaa                                                             1990
//

If you have problems or comments...

PBIL Back to PBIL home page