(data stored in ACNUC9543 zone)

EMBL: BC063744

ID   BC063744; SV 1; linear; mRNA; STD; VRT; 4541 BP.
XX
AC   BC063744;
XX
DT   10-DEC-2003 (Rel. 78, Created)
DT   27-JUN-2007 (Rel. 92, Last updated, Version 10)
XX
DE   Danio rerio DEAH (Asp-Glu-Ala-His) box polypeptide 38, mRNA (cDNA clone
DE   MGC:63517 IMAGE:2644058), complete cds.
XX
KW   MGC.
XX
OS   Danio rerio (zebrafish)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
OC   Actinopterygii; Neopterygii; Teleostei; Ostariophysi; Cypriniformes;
OC   Cyprinidae; Danio.
XX
RN   [1]
RP   1-4541
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-4541
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (08-DEC-2003) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; f07742b1705e45bace11d105167ae6fc.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Dr. Sumio Sugano and Dr. Ko-ichi Kawakami
CC   cDNA Library Preparation: Dr. Sumio Sugano and Dr. Ko-ichi Kawakami
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: Genome Sequence Centre,
CC   BC Cancer Agency, Vancouver, BC, Canada
CC   info@bcgsc.bc.ca
CC   Martin Hirst, Thomas Zeng, Ryan Morin, Michelle Moksa, Johnson
CC   Pang, Diana Mah, Jing Wang, Kieth Fichter, Eric Chuah, Allen
CC   Delaney, Rob Kirkpatrick, Agnes Baross, Sarah Barber, Mabel
CC   Brown-John, Steve S. Chand, William Chow, Ryan Babakaiff, Dave
CC   Wong, Corey Matsuo, Jaclyn Beland, Susan Gibson, Luis delRio, Ruth
CC   Featherstone, Malachi Griffith, Obi Griffith, Ran Guin, Nancy Liao,
CC   Kim MacDonald,  Mike R. Mayo, Josh Moran, Diana Palmquist, JR
CC   Santos, Duane Smailus, Jeff Stott, Miranda Tsai, George Yang,
CC   Jacquie Schein, Asim Siddiqui,Steven Jones, Rob Holt, Marco Marra.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAK Plate: 118 Row: f Column: 6
CC   This clone was selected for full length sequencing because it
CC   passed the following selection criteria: matched mRNA gi: 39644986.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..4541
FT                   /organism="Danio rerio"
FT                   /lab_host="DH10B"
FT                   /strain="AB"
FT                   /mol_type="mRNA"
FT                   /clone_lib="Sugano Kawakami zebrafish DRA"
FT                   /clone="MGC:63517 IMAGE:2644058"
FT                   /tissue_type="Whole body, adult, (one male and one female,
FT                   including unfertilized eggs)"
FT                   /note="Vector: pME18S-FL3"
FT                   /db_xref="taxon:7955"
FT   gene            1..4541
FT                   /gene="dhx38"
FT                   /note="synonym: zgc:63517"
FT   CDS_pept        197..3973
FT                   /codon_start=1
FT                   /gene="dhx38"
FT                   /product="DEAH (Asp-Glu-Ala-His) box polypeptide 38"
FT                   /db_xref="GOA:Q6P404"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR002464"
FT                   /db_xref="InterPro:IPR007502"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR011709"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q6P404"
FT                   /db_xref="ZFIN:ZDB-GENE-040426-1144"
FT                   /protein_id="AAH63744.1"
FT                   /translation="MDDDSSLHRLEGSDPSVQVGGLIVKKKSAATEQHVFRAPAPRTSL
FT                   LGLDLLAAQKRKEREGKERLDDQPKKSKVSSYKDWEEGKSDSGSDDENQEDGESRNGKK
FT                   ERKYRVTGSETPSNPGGVSEEFKRKHQQREKDRREHGVYASSKEDKSKDKNRSRDREHD
FT                   RHRDRERRKDRDERESSRSRGSSSSRSERSEGSVRSERSQREGCSERMSRGTRREEPES
FT                   PRNKPKDLATPSRCSWDEDDSGYASSRHSHWESPSPAPSHRENDRSERSQRSVRDSERR
FT                   DRSSKPQYPTDTPLPTPSYKYNEWANDRKHFGSTPRLSRGKGEKREEGEGGIQFDDEDE
FT                   KEQWEEDQRQADRDWYMMDEGYDEFHNPLTSSSDEYVKKREQILQKQTQKRISAQKRQI
FT                   NEDNERWETNRMLTSGVVQRLEVDEDFEEDNAARVHLLVHNLVPPFLDGRIVFTKQPEP
FT                   VIPVKDATSDMAIISRKGSQLVRRHREQKERKKAQHKHWELAGTKLGDIMGIQKKEDGG
FT                   DSKAVGEDGKVDYRAEQKFADHMKEKSEASSDFAKKKTLLEQRQYLPIFAVRQQLLNII
FT                   RDNNIVIVVGETGSGKTTQLTQYLHEDGYTSYGMVGCTQPRRVAAMSVAKRVSEEMNSN
FT                   LGEEVGYAIRFEDCTSEKTMIKYMTDGILLRESLRESDLDHYSAVIMDEAHERSLNTDV
FT                   LFGLLREVVSRRSDLKLIVTSATMDSDKFASFFGNVPIFHIPGRTFPVDILFSKTPQED
FT                   YVEAAVKQALQIHLSGMVGDILIFMPGQEDIEVTSDQIVERLADLENAPALAVLPIYSQ
FT                   LPSDLQAKIFQKAPDGVRKCIVATNIAETSLTVDGIMFVVDSGYCKLKVFNPRIGMDAL
FT                   QVYPISQANANQRAGRAGRTGPGQCYRLYTQSAFKNEMLTTTIPEIQRTNLANVVLLLK
FT                   SLGVQDLLLFHFMDPPPEDNMLNSMYQLWILGALDNTGALTPTGRLMVEFPLDPALSKM
FT                   LIVSCDMSCSADILIIVSMLSVPSIFYRPKGREEESDQVREKFSVPESDHLTYLNVYLQ
FT                   WKNNNYSSIWCNDHFIHTKAMRKVREVRAQLKDIMVQQKMNLISCGSDWDVIRKCICAA
FT                   YFHQAAKLKGIGEYVNVRTGMPCHLHPTSALFGMGYTPDYIIYHELVMTTKEYMQCVTA
FT                   VDGEWLAELGPMFYSIKHAGKSRQENRRRAKEEITNMEEEMSLAQEQIRARKEEQDRKN
FT                   NLGSVRAVKICTPGRKEEMTPMTPKRTPARFGL"
XX
SQ   Sequence 4541 BP; 1287 A; 1049 C; 1213 G; 992 T; 0 other;
     tgggatagta atggcggctt actgtacaca ttgttgacgt ttgccgctat gttatatatt        60
     tcttattttg ccacatcata cactacttct tttataccac cgagaagcgt tttgaggaac       120
     acatatatct gacgtccgag gatatcactg aaaagacgcg gtcggctgag acccatctgc       180
     tgtgcactgt gcagagatgg acgatgattc ctccctgcac cggctagaag gcagtgaccc       240
     gagtgttcag gtcgggggtc tgatagtgaa gaagaaaagc gctgcaacag aacagcacgt       300
     gttcagagcc cccgctccac gcacctcgct gctgggtctc gatctgctcg ctgcgcagaa       360
     acgcaaggag cgagagggca aggagaggct ggatgatcag cccaagaaat ccaaagtgtc       420
     atcctacaaa gactgggaag aggggaaaag tgattcgggg tctgatgatg aaaatcagga       480
     ggatggagag agcaggaatg ggaaaaaaga aaggaagtac agagtcactg gctcagaaac       540
     gccttcaaac cctggaggag tcagtgagga gttcaagagg aaacaccagc agagagagaa       600
     agaccgacgt gaacatgggg tttacgcttc atccaaagag gacaagagca aagacaagaa       660
     cagatccaga gacagagagc acgaccgcca tcgggacaga gagaggagaa aagacagaga       720
     tgagcgtgag agcagccgca gccgtggatc ctctagcagt cgctctgagc gcagtgaagg       780
     cagtgtaagg agtgaacgct ctcagagaga aggctgttct gagcgcatga gccgcggaac       840
     ccgccgcgag gagcctgaat caccccgaaa caaacctaaa gacttggcca ctccgtcgcg       900
     ctgcagctgg gatgaagatg acagtggata tgccagttca cgccactccc actgggagag       960
     tccgtctcct gccccctcac accgggagaa tgaccgctct gaacgcagcc agcgctcagt      1020
     gcgggacagc gagagaagag acagatcaag taaacctcag tatcctaccg atactccact      1080
     accgacccca tcatacaagt acaacgagtg ggccaatgac cgaaagcatt ttggctccac      1140
     accacgtctg tcccgcggga aaggagagaa gagagaggag ggagagggtg gcatccaatt      1200
     tgacgatgaa gatgagaagg agcagtggga ggaagatcag cggcaagcgg atcgagactg      1260
     gtacatgatg gatgaaggtt atgacgagtt tcacaaccca ctgacatcca gctcagacga      1320
     atatgtgaag aagcgggagc agatcctgca gaaacagacc cagaaacgca tctcggcaca      1380
     gaaaagacaa atcaatgagg ataacgaacg ctgggagacg aaccgcatgc tcaccagtgg      1440
     agtggttcag cgtctggagg tggatgagga ttttgaggaa gacaacgcag cccgagttca      1500
     tttacttgtg cataaccttg tgccaccctt cctcgatggg aggattgtct tcactaaaca      1560
     gcctgagccg gtcattccag tgaaagatgc gacctcagac atggccatca tctcccgtaa      1620
     aggcagtcaa ctggtgcgac gccaccgaga gcagaaagag agaaagaagg cacagcacaa      1680
     acactgggag ctcgctggca ccaaactggg tgacatcatg ggaatccaaa aaaaagagga      1740
     tgggggagac agtaaagctg ttggagaaga tggaaaagtg gattacagag ccgagcagaa      1800
     gtttgctgat cacatgaagg agaagagtga agcgagcagt gactttgcca agaagaagac      1860
     tctgttagag cagagacagt atctgcccat ctttgctgtt cgccagcagc tgctcaacat      1920
     catcagggat aacaatattg tgatagtggt gggtgaaacg ggcagtggta agacgacgca      1980
     gctaacgcag tatcttcatg aggacggtta caccagctat ggtatggtgg gctgcacaca      2040
     accccgcaga gtggcagcca tgagtgtggc taagagagtc agcgaagaga tgaacagtaa      2100
     tctgggagag gaggttggtt atgccatccg ttttgaagac tgtacatcag agaagacaat      2160
     gatcaagtac atgacggatg ggattctcct gagggagtct ctgcgggagt cagatctgga      2220
     tcactatagt gcagtaatca tggacgaggc ccacgagcgc tccctcaaca ctgatgtact      2280
     cttcgggctg cttcgagagg tggtgtcaag acgctccgac ttgaagctta ttgtcacatc      2340
     tgccaccatg gactcagaca aatttgcgtc attcttcggc aatgttccta ttttccacat      2400
     tcccggcagg actttcccag tggatatctt gttcagcaag actcctcagg aggactatgt      2460
     ggaggcggct gtgaaacagg ccttgcagat tcatctcagc gggatggtgg gtgacatcct      2520
     catcttcatg cctggtcagg aggacatcga ggtgacgtca gatcagattg tggaacggtt      2580
     ggccgatcta gagaacgctc cagccctggc agtgctgccc atctactccc agctgccctc      2640
     agacctgcag gccaagatct tccagaaggc tcctgatgga gtgaggaaat gtattgttgc      2700
     tacaaacatc gctgagacgt ctctgacagt ggacggcatc atgtttgtgg tggattccgg      2760
     ctattgtaaa ctgaaggtgt tcaaccctcg cattggcatg gatgcgcttc aggtttaccc      2820
     catcagtcaa gctaatgcaa accagcgggc tggtagagca ggcagaacag gcccaggaca      2880
     gtgttacagg ttatacacac agagcgcctt caagaatgaa atgctgacca ccactattcc      2940
     agagattcag cgcactaacc tggctaatgt tgtgcttttg ctcaagtcac tgggagttca      3000
     agacctcctg ctcttccact tcatggaccc gcccccagaa gacaacatgc tgaactccat      3060
     gtatcagctg tggatcttgg gtgcactcga caatacaggc gctctgacac ccaccgggcg      3120
     gctcatggtg gagtttcctc tggatccggc tctgtctaaa atgctgatcg tgtcttgtga      3180
     catgagctgc agtgctgaca tcctcatcat cgtctccatg ttgtctgtgc cgtccatctt      3240
     ctacaggcca aagggtcgag aggaggaaag tgaccaggtc agagagaagt tctccgtgcc      3300
     tgagagtgac catctgacct acctcaacgt ttacctgcag tggaagaaca acaattattc      3360
     cagcatctgg tgcaatgatc acttcattca caccaaagcc atgcggaagg tgcgtgaggt      3420
     gcgagctcag ctcaaagaca tcatggtgca gcagaaaatg aatctgatct cctgcggttc      3480
     agactgggac gtgatcagga agtgcatctg tgctgcatac tttcaccagg ctgctaaatt      3540
     aaagggaatt ggagagtatg tgaatgtgag aaccgggatg ccctgtcatc tgcaccccac      3600
     cagcgctttg ttcgggatgg gctacacccc tgactacatc atctaccatg aactggtcat      3660
     gaccacaaag gagtacatgc agtgtgtgac ggcagtggat ggtgagtggc tggctgagct      3720
     gggaccaatg ttctacagca tcaaacacgc agggaagagc agacaggaga accgaaggag      3780
     agccaaagag gagatcacca acatggagga ggagatgtct ctggcacaag agcagatccg      3840
     agcgcggaaa gaggagcagg acaggaagaa caatctgggc agcgtcaggg ccgtgaagat      3900
     ctgcacccca ggaaggaaag aggaaatgac gccgatgacg cccaaacgaa cgccggcccg      3960
     gtttggctta tagtgctcag tttctacaaa cgcataattg cttgcgtcag tgcagttttt      4020
     cctctaatat gtattcatca cagtgctttt tcatctttgg ccagcagtag gagcaattgt      4080
     ataaggagaa aaatctcttc ctccctctca cggtgttatt tgtggctctt tttaaccatg      4140
     ttcggactga gatcttacat tgaatcagtg cttaaattga agtgaacaca tttgttaggc      4200
     ttgcatttga tctaaaacaa caaaaacagc ataatttgac attaatatgc atattaggcc      4260
     caatcattct cttttttttt tatgtttcat gtttgtgtaa aaccagaact ctcgtgctca      4320
     ttcacctttt ttcaccatgt ctgatctgaa acaaaaacaa ccttgatctt acattgaatc      4380
     agtccttaaa ttgagaagtg aacacttttt ttatgcttgc atttgatcta aaaacaacta      4440
     aaatacagct taatttgaca ttaatatgca tatttacccc aatgatttct tttttctttt      4500
     aatttaatgt ctgatgtgtt tgcaaaaaaa aaaaaaaaaa a                          4541
//

If you have problems or comments...

PBIL Back to PBIL home page