(data stored in ACNUC31108 zone)

EMBL: BC063988

ID   BC063988; SV 1; linear; mRNA; STD; VRT; 2017 BP.
XX
AC   BC063988;
XX
DT   10-DEC-2003 (Rel. 78, Created)
DT   21-OCT-2008 (Rel. 97, Last updated, Version 7)
XX
DE   Danio rerio zgc:73292, mRNA (cDNA clone MGC:77871 IMAGE:7002540), complete
DE   cds.
XX
KW   MGC.
XX
OS   Danio rerio (zebrafish)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
OC   Actinopterygii; Neopterygii; Teleostei; Ostariophysi; Cypriniformes;
OC   Cyprinidae; Danio.
XX
RN   [1]
RP   1-2017
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-2017
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (08-DEC-2003) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; aec2360f28d0092b1676d6cc34deb481.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Len Zon, Harvard
CC   cDNA Library Preparation: Open Biosystems
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: Genome Sequence Centre,
CC   BC Cancer Agency, Vancouver, BC, Canada
CC   info@bcgsc.bc.ca
CC   Martin Hirst, Thomas Zeng, Ryan Morin, Michelle Moksa, Johnson
CC   Pang, Diana Mah, Jing Wang, Kieth Fichter, Eric Chuah, Allen
CC   Delaney, Rob Kirkpatrick, Agnes Baross, Sarah Barber, Mabel
CC   Brown-John, Steve S. Chand, William Chow, Ryan Babakaiff, Dave
CC   Wong, Corey Matsuo, Jaclyn Beland, Susan Gibson, Luis delRio, Ruth
CC   Featherstone, Malachi Griffith, Obi Griffith, Ran Guin, Nancy Liao,
CC   Kim MacDonald,  Mike R. Mayo, Josh Moran, Diana Palmquist, JR
CC   Santos, Duane Smailus, Jeff Stott, Miranda Tsai, George Yang,
CC   Jacquie Schein, Asim Siddiqui,Steven Jones, Rob Holt, Marco Marra.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAK Plate: 147 Row: o Column: 11
CC   This clone was selected for full length sequencing because it
CC   passed the following selection criteria: matched mRNA gi: 38174289.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2017
FT                   /organism="Danio rerio"
FT                   /lab_host="DH10B"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NIH_ZGC_10"
FT                   /clone="MGC:77871 IMAGE:7002540"
FT                   /tissue_type="Whole, adult zebrafish"
FT                   /note="Vector: pExpress1"
FT                   /db_xref="taxon:7955"
FT   gene            1..2017
FT                   /gene="zgc:73292"
FT                   /note="synonyms: fc18f11, fp72a01, wu:fp72a01, zgc:77871,
FT                   wu:fk50g10, fk50g10, wu:fc18f11, xx:fp72a01"
FT   CDS_pept        86..856
FT                   /codon_start=1
FT                   /gene="zgc:73292"
FT                   /product="zgc:73292"
FT                   /db_xref="GOA:Q6P3H3"
FT                   /db_xref="InterPro:IPR000301"
FT                   /db_xref="InterPro:IPR008952"
FT                   /db_xref="InterPro:IPR018499"
FT                   /db_xref="InterPro:IPR018503"
FT                   /db_xref="UniProtKB/TrEMBL:Q6P3H3"
FT                   /db_xref="ZFIN:ZDB-GENE-030131-2818"
FT                   /protein_id="AAH63988.1"
FT                   /translation="MGKGCITATKYFLFLFNFIFFIFGATIMGFGLWILLDNQSLIAVL
FT                   QESSVILKVVSYILIGVGSFSMLLGFLGCLGAIYEIRCLLGLYFTCLLLILLAQVAVSI
FT                   LIYFQRDLLKTEADKIVSQVVANYPGQNKTAEQAWDYLQRTMQCCGWNGRMDWDENHII
FT                   KNNTVPLYPCSCHNYSIQAPIVPDNGFCQASSSDWPIYQTGCLEHVGSWLFTNYGIILG
FT                   ICLGVAVIELLGMIFSMGLCKSVHQEDYTKVPKY"
XX
SQ   Sequence 2017 BP; 561 A; 397 C; 394 G; 665 T; 0 other;
     ctcatcaacg ctggacgaga cgcgcagctg acaactagtg tactttttca ttttcccata        60
     ctaaacgact ctaaacgtca gcaaaatggg gaaaggatgc ataactgcga ccaagtactt       120
     cctgtttctc ttcaacttca tcttctttat cttcggagcc acgattatgg gatttggact       180
     gtggatcctc ctagacaatc agagtctcat tgcagtgttg caggagtcat ccgtgatcct       240
     gaaggtggtc tcttatattc tgattggcgt gggctccttc tccatgcttc tggggtttct       300
     gggatgtctg ggagccatct atgaaatccg ctgcttgctt ggattgtact ttacctgtct       360
     attgctcatt ctcctggctc aagtggctgt gtccattctc atctacttcc agcgtgattt       420
     gttgaagact gaggcggata aaattgtgtc tcaagttgtg gcaaactacc ctggacagaa       480
     caaaaccgca gagcaggcct gggactacct gcagagaaca atgcagtgtt gtggctggaa       540
     tggacgcatg gactgggacg agaaccatat aataaagaac aatacagtgc cgctgtaccc       600
     atgctcctgc cacaattact ccatccaagc accaattgta cctgataacg gcttctgtca       660
     ggcctcttct agtgattggc ccatctatca gacgggctgt ctggagcatg tggggagctg       720
     gctcttcaca aattatggaa ttattttggg aatctgtctt ggggtggctg tcattgagct       780
     gcttggaatg atattttcta tgggcctttg caagagtgta caccaagagg attacaccaa       840
     agtaccgaag tactgagaag gaaacacgga cactcataca aaaatgtatt cagtcctttt       900
     ttctttttgg aaaaacagat ctccctcttt ttttctacag tatacacagt gtttccaaat       960
     gaaaaaaaaa tgtatgttta atcatgagac ttcacccgtt gtcagtaaca ctatccctgt      1020
     aatgagatct tcttagtcca ttttgaatag gccattgtat gacagtttga agtatagcac      1080
     atgaaggctg cccacataaa tgaatgaaac gtgtatgacg agactcgctg cccctgaatg      1140
     ctttatttat acaccaaaac tcattaacac ccattctagt ctgtttgctt tgatcataga      1200
     ggcccaaact acgagttaac agccaattaa acttcggttt gctctttata gacaacagga      1260
     aaaccacaaa gggcctgctt ttgttaaaac aggattttac tttgatattt agcattttgt      1320
     ggtatacata tactgacaca attcccaccc ttctgtagtg gcatgtctca aatacgaaag      1380
     ttttgttata tagtctgccg tttatgtttg tacatcagtg ttgtttcagg tttttctttt      1440
     attagtgtgt atatatttta ggtttcattt gcatgttcat ttggataagt tttgggagac      1500
     cttttttttg tacagatgat aaattgtatg tcttttttct acatgcgtaa atcgagctta      1560
     tttgtatgag cacgtttgta aggaagtaca atatgaagct attcctcgat gatgtgaacc      1620
     aaaattaaga gattcgcccc caaagttgac tgcagacttg atttattttg tattgcgttg      1680
     atcctaattt aaccgagttt ctcctctggc accactttgt ctttaattgt atacttgttt      1740
     ttgacaggta taatggaaga gttctaacag tgttttcttt atcatctgta acaattattt      1800
     tgcatttgta aaacttttag ttttgtaata taaggtactc acttatttta gtgttttgat      1860
     gttccaaaaa caaatcctat tttttgtaat actgggaata cagtccccta ccaagtaatt      1920
     atgatattat tgaagtattg taactacatg tacctttctt aagccgaatg tgatacaata      1980
     aataactcac ccaaaaaaaa aaaaaaaaaa aaaaaaa                               2017
//

If you have problems or comments...

PBIL Back to PBIL home page