(data stored in ACNUC10243 zone)

EMBL: BC064824

ID   BC064824; SV 1; linear; mRNA; STD; SYN; 2145 BP.
XX
AC   BC064824;
XX
DT   10-JAN-2004 (Rel. 78, Created)
DT   06-SEP-2016 (Rel. 129, Last updated, Version 10)
XX
DE   Synthetic construct Mus musculus heterogeneous nuclear ribonucleoprotein
DE   A3, mRNA (cDNA clone MGC:70231 IMAGE:6477672), complete cds.
XX
KW   MGC.
XX
OS   synthetic construct
OC   other sequences; artificial sequences.
XX
RN   [1]
RP   1-2145
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-2145
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (02-JAN-2004) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; 3c759e1767e4fc7ecf23c5e355a1f347.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Jeffrey E. Green, M.D.
CC   cDNA Library Preparation: Life Technologies, Inc.
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: Genome Sequence Centre,
CC   BC Cancer Agency, Vancouver, BC, Canada
CC   info@bcgsc.bc.ca
CC   Martin Hirst, Thomas Zeng, Ryan Morin, Michelle Moksa, Johnson
CC   Pang, Diana Mah, Jing Wang, Kieth Fichter, Eric Chuah, Allen
CC   Delaney, Rob Kirkpatrick, Agnes Baross, Sarah Barber, Mabel
CC   Brown-John, Steve S. Chand, William Chow, Ryan Babakaiff, Dave
CC   Wong, Corey Matsuo, Jaclyn Beland, Susan Gibson, Luis delRio, Ruth
CC   Featherstone, Malachi Griffith, Obi Griffith, Ran Guin, Nancy Liao,
CC   Kim MacDonald,  Mike R. Mayo, Josh Moran, Diana Palmquist, JR
CC   Santos, Duane Smailus, Jeff Stott, Miranda Tsai, George Yang,
CC   Jacquie Schein, Asim Siddiqui,Steven Jones, Rob Holt, Marco Marra.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAK Plate: 131 Row: n Column: 18.
CC   Differences found between this sequence and the mouse C57BL/6J
CC   genome (build 37) are described in misc_difference features below.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2145
FT                   /organism="synthetic construct"
FT                   /lab_host="DH10B"
FT                   /mol_type="mRNA"
FT                   /isolation_source="Mus musculus; FVB/N; Colon, normal. 5
FT                   month old male mouse."
FT                   /clone_lib="NCI_CGAP_Co24"
FT                   /clone="MGC:70231 IMAGE:6477672"
FT                   /note="Vector: pCMV-SPORT6"
FT                   /db_xref="taxon:32630"
FT   gene            1..2145
FT                   /gene="Hnrpa3"
FT                   /gene_synonym="hnRNPA3"
FT                   /gene_synonym="MGC37309"
FT   misc_difference 1..24
FT                   /gene="Hnrpa3"
FT                   /gene_synonym="hnRNPA3"
FT                   /gene_synonym="MGC37309"
FT                   /note="24 bases at the 5' end do not align to the mouse
FT                   genome."
FT   CDS_pept        25..1164
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="Hnrpa3"
FT                   /gene_synonym="hnRNPA3"
FT                   /gene_synonym="MGC37309"
FT                   /product="heterogeneous nuclear ribonucleoprotein A3"
FT                   /db_xref="GOA:Q8BG05"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR034513"
FT                   /db_xref="InterPro:IPR034516"
FT                   /db_xref="InterPro:IPR035979"
FT                   /db_xref="MGI:MGI:1917171"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8BG05"
FT                   /protein_id="AAH64824.1"
FT                   /translation="MEVKPPPGRPQPDSGRRRRRRGEEGHDPKEPEQLRKLFIGGLSFE
FT                   TTDDSLREHFEKWGTLTDCVVMRDPQTKRSRGFGFVTYSCVEEVDAAMCARPHKVDGRV
FT                   VEPKRAVSREDSVKPGAHLTVKKIFVGGIKEDTEEYNLRDYFEKYGKIETIEVMEDRQS
FT                   GKKRGFAFVTFDDHDTVDKIVVQKYHTINGHNCEVKKALSKQEMQSAGSQRGRGGGSGN
FT                   FMGRGGNFGGGGGNFGRGGNFGGRGGYGGGGGGSRGSYGGGDGGYNGFGGDGGNYGGGP
FT                   GYSSRGGYGGGGPGYGNQGGGYGGGGGGYDGYNEGGNFGGGNYGGGGNYNDFGNYSGQQ
FT                   QSNYGPMKGGSFGGRSSGSPYGGGYGSGGGSGGYGSRRF"
FT   misc_difference 2127..2145
FT                   /gene="Hnrpa3"
FT                   /gene_synonym="hnRNPA3"
FT                   /gene_synonym="MGC37309"
FT                   /note="polyA tail: 19 bases do not align to the mouse
FT                   genome."
XX
SQ   Sequence 2145 BP; 618 A; 363 C; 586 G; 578 T; 0 other;
     cccacgcgtc cgcggacgcg tgggatggag gtaaaaccgc cgcccggtcg cccccagcct        60
     gactccggcc gtcgccgccg ccgccggggg gaggagggcc atgatccaaa ggaaccagag       120
     cagctgagga agctatttat tggtggtctg agctttgaaa ccacagatga tagcttaaga       180
     gaacattttg agaaatgggg cacacttaca gactgtgtgg taatgagaga tccccaaaca       240
     aaacgttcca gaggctttgg ttttgtgacc tactcttgtg ttgaagaggt ggatgctgca       300
     atgtgtgctc ggccacacaa ggttgatggg cgtgtggtgg aaccgaagag agctgtttct       360
     agagaggatt ctgtaaagcc tggtgcccat ttaacggtga agaaaatttt tgttggtggt       420
     attaaagagg atacggaaga atataacctg agagactact ttgaaaagta tggcaagatt       480
     gaaaccatag aggttatgga agacaggcag agtgggaaaa agagaggatt tgcttttgta       540
     acttttgatg atcatgacac agttgataaa attgttgttc agaaatacca cactattaat       600
     gggcataatt gtgaagtgaa aaaggccctt tctaaacaag agatgcagtc tgctggatca       660
     cagagaggtc gtggaggtgg atctggcaac tttatgggtc gtggaggaaa ctttggaggt       720
     ggtggaggaa actttggtcg tggaggaaac tttggtggaa gaggtggcta tggtggtgga       780
     ggtggtggca gcagaggtag ttatggaggt ggtgatggtg gatataatgg atttggaggt       840
     gatggtggca actatggtgg tggtcctggt tacagcagta gaggaggtta tggaggtggt       900
     ggaccaggat atggaaacca gggtggtgga tatggtggtg gaggaggagg ctatgatggt       960
     tacaatgaag gaggaaattt tggtggaggt aactatggtg gtggtggaaa ctataatgac      1020
     tttggaaatt atagtggaca gcaacaatca aattatggac ccatgaaggg gggcagtttt      1080
     ggtggaagaa gctcaggcag tccctatggt ggtggctatg gatctggagg tggaagtggt      1140
     ggatatggta gcagaaggtt ttaaaataaa acagaaacgg tgaatgagaa ccctacctgc      1200
     ctaacgagga atgtctttcc cacaccttaa atacgaaggt ttctggctgg gtaaggtttg      1260
     tagctcacag taaaaaccga tgacactgtt ggtttcccac aagtcaatgt cacagttgag      1320
     acacccctca agctcagttt tgttttggtg cccattgaac aaattctaag acataggcag      1380
     ttacattctg caaagccatg ggtgtttgtc ataagctaga tgtgcctctt catgtgtaca      1440
     actcaatgtt ctaaggtaaa gtcatccttc aataagggga agtcatgttg gcttttcaaa      1500
     agtaagtttt tcatgtatga ctttaataag ctgttcccac cctaagaact aggaactttc      1560
     acagttgtca gaataattgt cttccttaaa gctctatagc gtgtaagttt actcttgtgt      1620
     ggaccagtag ggatagtcaa gtgtttagtc ttctccccta acccatcaca aacagggtct      1680
     cactgttgtc ctagcctgga actcaatcca ccagccttct gtgtctccca agtgctggag      1740
     ttaaaagggt ggtgcctgta tgataactca agttcctttt taaaaaaaca tccaaagaac      1800
     agttgggtta ctattcacat aatgttgctg gttgttcata agggctattt ctgctgccct      1860
     gaaagggctt atttgaaaat tgcttaattc aggttacttc ttaatagaac attttcaggg      1920
     gacaaatctg caaaatgttt cccacacagg gaacatccct gcatcaacaa gtttgcttgg      1980
     catttaagtc aggacaaagt tcacagaaat catagttacc aatgaggtag caatcgttca      2040
     atggtggtta acagattgga gaaaatacat ttgcttagga ggcatttaca gtccatttcc      2100
     tttctgaaat aaagttattt tactaaaaaa aaaaaaaaaa aaaaa                      2145
//

If you have problems or comments...

PBIL Back to PBIL home page