(data stored in ACNUC24361 zone)

EMBL: BC065241

ID   BC065241; SV 1; linear; mRNA; STD; HUM; 2362 BP.
XX
AC   BC065241;
XX
DT   14-JAN-2004 (Rel. 78, Created)
DT   17-APR-2005 (Rel. 83, Last updated, Version 4)
XX
DE   Homo sapiens zinc finger protein 323, mRNA (cDNA clone MGC:70898
DE   IMAGE:6016003), complete cds.
XX
KW   MGC.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-2362
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-2362
RA   Strausberg R.;
RT   ;
RL   Submitted (12-JAN-2004) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Cancer
RL   Genomics Office, National Cancer Institute, 31 Center Drive, Room 11A03,
RL   Bethesda, MD 20892-2590, USA
XX
DR   MD5; 263fbb12af5ea5ac4fdccc68b27e9ae2.
DR   Ensembl-Gn; ENSG00000235109; homo_sapiens.
DR   Ensembl-Tr; ENST00000344279; homo_sapiens.
DR   Ensembl-Tr; ENST00000396838; homo_sapiens.
DR   Ensembl-Tr; ENST00000414429; homo_sapiens.
DR   Ensembl-Tr; ENST00000439158; homo_sapiens.
DR   Ensembl-Tr; ENST00000446474; homo_sapiens.
DR   Ensembl-Tr; ENST00000611469; homo_sapiens.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: ATCC
CC   cDNA Library Preparation: Life Technologies, Inc.
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: National Institutes of Health Intramural
CC   Sequencing Center (NISC),
CC   Gaithersburg, Maryland;
CC   Web site: http://www.nisc.nih.gov/
CC   Contact: nisc_mgc@nhgri.nih.gov
CC   Akhter,N., Ayele,K., Beckstrom-Sternberg,S.M., Benjamin,B.,
CC   Blakesley,R.W., Bouffard,G.G., Breen,K., Brinkley,C., Brooks,S.,
CC   Dietrich,N.L., Granite,S., Guan,X., Gupta,J., Haghighi,P.,
CC   Hansen,N., Ho,S.-L., Karlins,E., Kwong,P., Laric,P., Legaspi,R.,
CC   Maduro,Q.L., Masiello,C., Maskeri,B., Mastrian,S.D.,McCloskey,J.C.,
CC   McDowell,J., Pearson,R., Stantripop,S., Thomas,P.J., Touchman,J.W.,
CC   Tsurgeon,C., Vogt,J.L., Walker,M.A., Wetherby,K.D., Wiggins,L.,
CC   Young,A., Zhang,L.-H. and Green,E.D.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAK Plate: 140 Row: b Column: 9
CC   This clone was selected for full length sequencing because it
CC   passed the following selection criteria: Similarity but not
CC   identity to protein.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2362
FT                   /organism="Homo sapiens"
FT                   /lab_host="DH10B"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NIH_MGC_92"
FT                   /clone="MGC:70898 IMAGE:6016003"
FT                   /tissue_type="Testis, embryonal carcinoma"
FT                   /note="Vector: pCMV-SPORT6"
FT                   /db_xref="taxon:9606"
FT   gene            1..2362
FT                   /gene="ZNF323"
FT                   /note="synonym: FLJ23407"
FT   CDS_pept        172..915
FT                   /codon_start=1
FT                   /gene="ZNF323"
FT                   /product="ZNF323 protein"
FT                   /db_xref="GOA:Q96LW9"
FT                   /db_xref="H-InvDB:HIT000261804.14"
FT                   /db_xref="HGNC:HGNC:14097"
FT                   /db_xref="InterPro:IPR003309"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR036236"
FT                   /db_xref="InterPro:IPR038269"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q96LW9"
FT                   /protein_id="AAH65241.1"
FT                   /translation="MVTQLRYESFCLHQFQEQDGESIPENQELASKQEILKEMEHLGDS
FT                   KLQRDVSLDSKYRETCKRDSKAEKQQAHSTGERRHRCNECGKSFTKSSVLIEHQRIHTG
FT                   EKPYECEECGKAFSRRSSLNEHRRSHTGEKPYQCKECGKAFSASNGLTRHRRIHTGEKP
FT                   YECKVCGKAFLLSSCLVQHQRIHTGEKRYQCRECGKAFIQNAGLFQHLRVHTGEKPYQC
FT                   SQCSKLFSKRTLLKKHQKIHTGERP"
XX
SQ   Sequence 2362 BP; 755 A; 448 C; 487 G; 672 T; 0 other;
     gcctttcttt gtctgagata acgcccggag ttctttgtcc tgcctccaag acgataaagg        60
     agcgcagaca caaaggctcc agaccatgaa catggacatt ctgaagtgct cttggaggat       120
     gtggaacatc tgaaggtcaa gcaggaacca acagacatac agcttcagcc tatggtgaca       180
     cagctcagat atgaatcttt ttgcctccac caatttcaag aacaagatgg tgaaagtata       240
     cctgagaacc aggagttggc atcaaagcaa gaaatcttaa aagaaatgga acatttgggg       300
     gatagcaaac tccaaagaga tgtatctttg gattctaagt acagagaaac ttgtaaacga       360
     gacagcaagg cagaaaagca gcaggcacat tccactggag agagacgcca caggtgcaat       420
     gaatgtggga aaagcttcac taagagttca gtactcattg agcaccagag aatccacact       480
     ggggagaagc catatgaatg tgaagaatgt gggaaggcct tcagccggag gtcaagcctg       540
     aatgaacatc ggcggagcca cactggagag aaaccctatc aatgtaagga gtgtgggaaa       600
     gccttcagtg ccagcaatgg cctcactcga cacagaagaa tccacacagg ggaaaaacca       660
     tatgaatgca aagtgtgtgg gaaggctttc ctcctcagct catgccttgt tcagcatcag       720
     aggatacaca ctggagagaa gcgctatcag tgtcgtgagt gtggcaaagc cttcattcag       780
     aatgcagggc ttttccagca tctccgagtc cacactggtg agaaacccta tcagtgcagt       840
     cagtgcagta aactctttag taagcggaca cttcttaaga aacatcagaa aatccacact       900
     ggagagagac cataagggtg atgagtttgg gaaagccttc agtcatcatt gcaaccttat       960
     taggcatttt agaatccata ctgttccagc agaactggac taattctgtg gaccctcaga      1020
     cccctaaatg gggccgtctt ggaaagtaag attttcaagt ggcttattct gttcttataa      1080
     aatttatttt gtattgcatt gaaccacttg tctacaaacc aggtgttggt gtctcctgtg      1140
     tggatgactg tgattgtagg gggttgctgg gtggccttct tattccctag cctttggtcc      1200
     atttcttatg atttccttta aaggcaccaa atcttatctg gaaataaatt gttatggagg      1260
     ggctgttttt gagcaatact gcatattgaa caattctaaa agaccagtat ctatgtatac      1320
     ttttaaaaaa aagatttgct aagatcaaag gatattcaga ggtgcatctt tttctgtaag      1380
     agtgacattt taaacaaatg taaggttttg gggaataaga atcgtccaca ttcccacagg      1440
     aaatcattgc tatggtctcc cctaggaatg tgatagatag cttctataat tatgcagcat      1500
     tatccatagt atgaaacctg tagttttaat ggtttagaaa tctatgtctc atttcatatc      1560
     taactcatgt ttttgatacg aatcaatata tatgttgata tcatgagtta atatgagttt      1620
     gacatgaatc atcaacatag tatatacata tcaacataac tatgttgatg attcatatca      1680
     aattctcaat gcaggtcatt actgtaagtt ttccattttt gttacaaata ataagtaaga      1740
     tgatacttta aaatctctgt tcttcacaag gtacctcttt aattcatagc cttttatgtc      1800
     agcattattc ttcttttggg ggttggtcag caactttgag tgccattgca agcagcatca      1860
     tttaagtagt tttataaaga aaagaagtct gatatcttgg gcagcttgct gcttactggg      1920
     gagaccagca tgcttagaca cttattgcca gggttaaaca tatgctctgg caccaagttc      1980
     aaatctttcc tccccatttg tgagctgtgg gactttaggc aagttatcta aatgctgcta      2040
     tgctatagtc tccccacctg taaaacagag gatgatacca ataccttcct catagggtac      2100
     ataagattaa ataaatacaa acttgtactt aaaatgtagc tctcaataaa tatgcattat      2160
     gatttacata cgaaataata gcatttaaca aatgtaggta gaattttaag tatcatgtta      2220
     aaattaggat acgaaatgcc tctgctgaca ttcttgttac tcttttctcc acagtcaaaa      2280
     cctgaatcag aatatttcaa aagagaggaa ataaaagttc agcttaaaac tgttctgccc      2340
     taaaaaaaaa aaaaaaaaaa aa                                               2362
//

If you have problems or comments...

PBIL Back to PBIL home page