(data stored in ACNUC10243 zone)

EMBL: BC065334

ID   BC065334; SV 1; linear; mRNA; STD; VRT; 1394 BP.
XX
AC   BC065334;
XX
DT   15-JAN-2004 (Rel. 78, Created)
DT   17-APR-2005 (Rel. 83, Last updated, Version 4)
XX
DE   Danio rerio heterogeneous nuclear ribonucleoprotein A0, like, mRNA (cDNA
DE   clone IMAGE:6964916), partial cds.
XX
KW   .
XX
OS   Danio rerio (zebrafish)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
OC   Actinopterygii; Neopterygii; Teleostei; Ostariophysi; Cypriniformes;
OC   Cyprinidae; Danio.
XX
RN   [1]
RP   1-1394
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-1394
RA   Strausberg R.;
RT   ;
RL   Submitted (12-JAN-2004) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Cancer
RL   Genomics Office, National Cancer Institute, 31 Center Drive, Room 11A03,
RL   Bethesda, MD 20892-2590, USA
XX
DR   MD5; 17a109e2615abecfec8a836772839f2b.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Leonard I. Zon, M.D.
CC   cDNA Library Preparation: Invitrogen Corp
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: National Institutes of Health Intramural
CC   Sequencing Center (NISC),
CC   Gaithersburg, Maryland;
CC   Web site: http://www.nisc.nih.gov/
CC   Contact: nisc_mgc@nhgri.nih.gov
CC   Akhter,N., Ayele,K., Beckstrom-Sternberg,S.M., Benjamin,B.,
CC   Blakesley,R.W., Bouffard,G.G., Breen,K., Brinkley,C., Brooks,S.,
CC   Dietrich,N.L., Granite,S., Guan,X., Gupta,J., Haghighi,P.,
CC   Hansen,N., Ho,S.-L., Karlins,E., Kwong,P., Laric,P., Legaspi,R.,
CC   Maduro,Q.L., Masiello,C., Maskeri,B., Mastrian,S.D.,McCloskey,J.C.,
CC   McDowell,J., Pearson,R., Stantripop,S., Thomas,P.J., Touchman,J.W.,
CC   Tsurgeon,C., Vogt,J.L., Walker,M.A., Wetherby,K.D., Wiggins,L.,
CC   Young,A., Zhang,L.-H. and Green,E.D.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAK Plate: 146 Row: g Column: 23
CC   This clone was selected for full length sequencing because it
CC   passed the following selection criteria: Hexamer frequency ORF
CC   analysis, Similarity but not identity to protein.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1394
FT                   /organism="Danio rerio"
FT                   /lab_host="DH10B"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NCI_CGAP_ZEmb2"
FT                   /clone="IMAGE:6964916"
FT                   /tissue_type="Embryo, zebrafish 24 hpf"
FT                   /note="Vector: pCMV-SPORT6.1"
FT                   /db_xref="taxon:7955"
FT   gene            <1..1394
FT                   /gene="hnrpa0l"
FT                   /note="synonyms: fb38a07, wu:fb38a07"
FT   CDS_pept        <1..900
FT                   /codon_start=1
FT                   /gene="hnrpa0l"
FT                   /product="hnrpa0l protein"
FT                   /db_xref="GOA:Q6P113"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR034801"
FT                   /db_xref="InterPro:IPR035979"
FT                   /db_xref="UniProtKB/TrEMBL:Q6P113"
FT                   /db_xref="ZFIN:ZDB-GENE-030131-618"
FT                   /protein_id="AAH65334.1"
FT                   /translation="QLCKLFVGGLNVQTTDEGLRAHFEQYGQLTDCVVVMNQPLQRSRC
FT                   FGFVTYSSIEEADAAMSARPHIVDGNNVDLKRAVAREDAGKPEMLAKVKKIFVGGLKDD
FT                   IEDEHLQDYFSQFGPIEKAQVITDKDTGKKRGFGFVYFDDNDSADKAVVMKFHSICGHK
FT                   VEVKKALTKQEMQSTGGGRGGRGGRGMGRGSGFGGGGRGGYYNDYGYQNNGFGNNSGYD
FT                   SQNGYGGGYSDQMGGGYGNGNGYSDFGEGYGQQASGYGAMKTGYGNYSSGRQSSGPYPR
FT                   GGGGGGSGGYGRGGYGGY"
XX
SQ   Sequence 1394 BP; 371 A; 295 C; 382 G; 346 T; 0 other;
     caactctgta aactcttcgt cggcggcttg aacgtccaaa caaccgatga aggcttgcgg        60
     gcacatttcg agcaatatgg acagctaacc gactgcgtgg tggtgatgaa ccagccgcta       120
     cagcgctcca ggtgcttcgg ctttgtaaca tactcgagca tcgaggaagc ggacgccgcc       180
     atgtctgcta ggcctcatat cgtagacggc aacaacgtgg atctgaagcg agcggtggcc       240
     cgggaagacg ccggtaaacc ggagatgctc gctaaggtca agaaaatatt cgttggtgga       300
     ctgaaagacg acatcgagga cgaacacctt caagattatt tctcacagtt tgggcccatc       360
     gagaaggcgc aggtcatcac cgacaaagac accgggaaga agcgaggctt cggctttgtt       420
     tacttcgacg acaacgattc tgccgacaaa gccgtcgtga tgaagttcca ctccatctgc       480
     ggacacaagg tggaggtgaa gaaagcgctc actaagcagg agatgcagtc caccggtggc       540
     ggtcgcggcg gcagaggagg ccgaggaatg ggccggggaa gcggctttgg tggcggcgga       600
     agagggggtt actataacga ctacggctac cagaacaacg gcttcggcaa caattccggc       660
     tacgacagtc aaaacggcta cggaggcggt tatagtgacc agatgggcgg tggatacggc       720
     aacgggaatg gctacagtga tttcggcgag ggttatggac agcaggcttc gggctacggc       780
     gctatgaaaa cgggctacgg gaattattct tccggtaggc agagcagtgg gccgtaccca       840
     cgtgggggag gaggcggcgg tagtggcggc tacggaagag gaggatatgg aggctattag       900
     aagcactaat gtgactctaa gctgcgtttt tacttttatt tttttaagca aactatttgg       960
     actctggact ttcaaaatat tcggtattgg tttaaataag agcatcgttc tgtgccatta      1020
     ccagtaccag cagacacgcg ttgcgtttct tttctttgtt tcggttttag gtggtcatgt      1080
     gttacccaag tcaagcctgt aaaacaccag tgtaggcttt tgtgtgatct gtttctaggt      1140
     ttattgcctg tccattgttt ggagacgaaa ctcaggggta ataatgaaat ttaagcagct      1200
     cgttttcatc gtgacctcct aatattcttt gttttttgag tgtaatataa tttttgtttt      1260
     aatgctgtca caccgttcct attgtacaac tgttttaaag tttttcattt gatctgaaag      1320
     ttgccatacg ccttttgacc attaaaaacc aatctttttc ataaaaaaaa aaaaaaaaaa      1380
     aaaaaaaaaa aaaa                                                        1394
//

If you have problems or comments...

PBIL Back to PBIL home page