(data stored in ACNUC27125 zone)

EMBL: BC065500

ID   BC065500; SV 1; linear; mRNA; STD; HUM; 1009 BP.
XX
AC   BC065500;
XX
DT   30-JAN-2004 (Rel. 78, Created)
DT   15-OCT-2008 (Rel. 97, Last updated, Version 5)
XX
DE   Homo sapiens family with sequence similarity 21, member A, mRNA (cDNA clone
DE   IMAGE:3868091), partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1009
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-1009
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (26-JAN-2004) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; a0b8de0e1261a4afd04d80dbcea036bb.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: ATCC
CC   cDNA Library Preparation: Life Technologies, Inc.
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: National Institutes of Health Intramural
CC   Sequencing Center (NISC),
CC   Gaithersburg, Maryland;
CC   Web site: http://www.nisc.nih.gov/
CC   Contact: nisc_mgc@nhgri.nih.gov
CC   Akhter,N., Ayele,K., Beckstrom-Sternberg,S.M., Benjamin,B.,
CC   Blakesley,R.W., Bouffard,G.G., Breen,K., Brinkley,C., Brooks,S.,
CC   Dietrich,N.L., Granite,S., Guan,X., Gupta,J., Haghighi,P.,
CC   Hansen,N., Ho,S.-L., Karlins,E., Kwong,P., Laric,P., Legaspi,R.,
CC   Maduro,Q.L., Masiello,C., Maskeri,B., Mastrian,S.D.,McCloskey,J.C.,
CC   McDowell,J., Pearson,R., Stantripop,S., Thomas,P.J., Touchman,J.W.,
CC   Tsurgeon,C., Vogt,J.L., Walker,M.A., Wetherby,K.D., Wiggins,L.,
CC   Young,A., Zhang,L.-H. and Green,E.D.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAK Plate: 134 Row: c Column: 7.
CC   Differences found between this sequence and the human reference
CC   genome (build 36) are described in misc_difference features below.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1009
FT                   /organism="Homo sapiens"
FT                   /lab_host="DH10B"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NIH_MGC_67"
FT                   /clone="IMAGE:3868091"
FT                   /tissue_type="Eye, retinoblastoma"
FT                   /note="Vector: pCMV-SPORT6"
FT                   /db_xref="taxon:9606"
FT   gene            <1..1009
FT                   /gene="FAM21A"
FT                   /note="synonym: bA56A21.1"
FT   CDS_pept        <1..382
FT                   /codon_start=2
FT                   /gene="FAM21A"
FT                   /product="FAM21A protein"
FT                   /db_xref="H-InvDB:HIT000261908.13"
FT                   /db_xref="UniProtKB/TrEMBL:Q6P0Q7"
FT                   /protein_id="AAH65500.1"
FT                   /translation="KNETKSNSQQDVILTTQDIFEDDIFATEAIKPSQKTREKEKTLES
FT                   NLFDDNIDIFADLTVKPKEKSKKKVEAKSIFDDDMDDIFSSGIQAKTTKPKSRSAQAAP
FT                   EPRFEHKVSNIFDDPLNAFGGQ"
FT   misc_difference 947..1009
FT                   /gene="FAM21A"
FT                   /note="polyA tail: 63 bases do not align to the human
FT                   genome."
XX
SQ   Sequence 1009 BP; 370 A; 177 C; 200 G; 262 T; 0 other;
     gaagaatgag acaaaatcca atagtcagca ggatgtcata ttaacaacac aagatatttt        60
     tgaggatgat atatttgcta cggaagcaat taaaccctct cagaaaacca gagagaagga       120
     gaaaacattg gaatctaatt tatttgatga taacattgat atctttgctg acttaactgt       180
     aaaaccaaaa gaaaagtcca aaaagaaagt ggaagccaag tctatatttg atgatgatat       240
     ggatgacatc ttctcctctg gtatccaggc taagacaacc aaaccaaaaa gccgatctgc       300
     acaggccgca cctgaaccaa gatttgaaca caaggtgtcc aacatctttg atgatcccct       360
     gaatgccttt ggaggccagt agagcacaca gggtatccac atgttaccct gcagctacat       420
     tgttgagtta gtgatgatgt tgtatatgct gatggtctta actggattac aaaaagcaaa       480
     tactagaaca gctagctcat cgttcaccca atgtacttgg tatttttctg cactggttta       540
     atcatgctta atactacaaa acaaaaataa atatttcaca gtggttggtt tgttttgttt       600
     ttaaaccaca gtttgattta gttagccttg ctggggccat aatatgcttc agggtgtgta       660
     aaagaagaaa tctctttgtg gctttcatgg gcagggaatc ccagagatag caaatgccac       720
     ctgaccagaa gtctttgtta tatggatggg aaccctaact tagggcctgg gcaggggaaa       780
     gagaaagaag gtgagagatt atacttcatg agtcttagca atatgggagc aggttttcac       840
     tgaattctga gggtgcctct gcatgtcctc caaggcaaag tttggcaaac tgtggccccc       900
     ccactgtcat attttgttaa taaaatttta ttggaacaca accacaaaaa aaaaaaaaaa       960
     aaaaaaaaaa aaaaaaaaaa aaaaaaaaaa aaaaaaaaaa aaaaaaaaa                  1009
//

If you have problems or comments...

PBIL Back to PBIL home page