(data stored in ACNUC27125 zone)

EMBL: BC066000

ID   BC066000; SV 1; linear; mRNA; STD; MUS; 3173 BP.
XX
AC   BC066000;
XX
DT   04-FEB-2004 (Rel. 78, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 12)
XX
DE   Mus musculus protein phosphatase 3, catalytic subunit, beta isoform, mRNA
DE   (cDNA clone MGC:91348 IMAGE:5699179), complete cds.
XX
KW   MGC.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-3173
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-3173
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (02-FEB-2004) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; 826dc542ee797f08dec8ece59c63dde7.
DR   Ensembl-Gn; ENSMUSG00000021816; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0021038; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0020987; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0020964; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0020990; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0020774; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0021423; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0020298; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0020740; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0020863; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0020846; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0020939; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0020872; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0021456; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0020047; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0020354; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000159027; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0038426; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0038383; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0038347; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0038388; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0038131; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0038846; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0038133; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0038049; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0038194; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0038164; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0038312; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0038147; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0038890; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0037755; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0037541; mus_musculus_wsbeij.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Dr. Jim Lin, University of Iowa
CC   cDNA Library Preparation: M. Bento Soares, University of Iowa
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: University of Iowa, Dr. M. Bento Soares and Dr.
CC   Thomas L. Casavant.
CC   Web site: http://genome.uiowa.edu
CC   Contact: bento-soares@uiowa.edu; tom-casavant@uiowa.edu
CC   Bonaldo,M.F., Akabogu,I.,  Bair,T., Bair,J., Crouch,K., Davis,A.,
CC   Fishler,K., Keppel,C., Kucaba,T., Lebeck,M., Melo,A., Schaefer,K.,
CC   Scheetz,T., Smith,C., Snir,E., Tack,D., Trout,K., Walters,J.,
CC   Casavant,T., Soares,M.B.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series:  Plate:  Row:  Column: 0.
CC   Differences found between this sequence and the mouse C57BL/6J
CC   genome (build 36) are described in misc_difference features below.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3173
FT                   /organism="Mus musculus"
FT                   /lab_host="DH10B"
FT                   /strain="C57BL/6"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NIH_BMAP_EQ0"
FT                   /clone="MGC:91348 IMAGE:5699179"
FT                   /tissue_type="Brain, whole, 18.5 dpc mouse embryo"
FT                   /note="Vector: pYX-ASC"
FT                   /db_xref="taxon:10090"
FT   gene            1..3173
FT                   /gene="Ppp3cb"
FT                   /note="synonym: CnAbeta"
FT   CDS_pept        105..1682
FT                   /codon_start=1
FT                   /gene="Ppp3cb"
FT                   /product="protein phosphatase 3, catalytic subunit, beta
FT                   isoform"
FT                   /db_xref="GOA:P48453"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR006186"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="InterPro:IPR041751"
FT                   /db_xref="MGI:MGI:107163"
FT                   /db_xref="UniProtKB/Swiss-Prot:P48453"
FT                   /protein_id="AAH66000.1"
FT                   /translation="MAAPEPARAAPPPPPPPPPPLGADRVVKAVPFPPTHRLTSEEVFD
FT                   MDGIPRVDVLKNHLVKEGRVDEEIALRIINEGAAILRREKTMIEVEAPITVCGDIHGQF
FT                   FDLMKLFEVGGSPANTRYLFLGDYVDRGYFSIECVLYLWVLKILYPSTLFLLRGNHECR
FT                   HLTEYFTFKQECKIKYSERVYEACMEAFDSLPLAALLNQQFLCVHGGLSPEIHTLDDIR
FT                   RLDRFKEPPAFGPMCDLLWSDPSEDFGNEKSQEHFSHNTVRGCSYFYNYPAVCEFLQNN
FT                   NLLSIIRAHEAQDAGYRMYRKSQTTGFPSLITIFSAPNYLDVYNNKAAVLKYENNVMNI
FT                   RQFNCSPHPYWLPNFMDVFTWSLPFVGEKVTEMLVNVLSICSDDELMTEGEDQFDVGSA
FT                   AARKEIIRNKIRAIGKMARVFSVLREESESVLTLKGLTPTGMLPSGVLAGGRQTLQSAT
FT                   VEAIEAEKAIRGFSPPHRICSFEEAKGLDRINERMPPRKDAVQQDGFNSLNTAHTTENH
FT                   GTGNHSAQ"
FT   misc_difference 1824
FT                   /gene="Ppp3cb"
FT                   /note="1 base in cDNA is not found in the mouse genome."
FT   misc_difference 3128..3173
FT                   /gene="Ppp3cb"
FT                   /note="polyA tail: 46 bases do not align to the mouse
FT                   genome."
XX
SQ   Sequence 3173 BP; 951 A; 630 C; 677 G; 915 T; 0 other;
     gggtccgcca tgttccccgg cggcgccgcc gcttggctct ggtagccgcc gcccccgccc        60
     ccaaccccgc ccgtcccggc acctagccga gccccgggcc cagcatggcc gccccggagc       120
     cggcccgggc cgcgccgccc ccgcccccgc ccccaccgcc ccctctcggg gccgaccgcg       180
     tcgtcaaagc tgttcctttt cccccaactc atcggctgac atctgaagaa gtgtttgata       240
     tggatgggat acccagggtt gatgttctga agaaccactt ggtaaaagaa gggcgggtgg       300
     atgaagaaat tgcactaaga attatcaatg agggtgctgc catacttcgg cgggagaaaa       360
     ccatgataga agtagaagct ccaattacag tgtgtggtga catccatggc caattttttg       420
     atctgatgaa actttttgaa gtaggaggat cacctgctaa tacacgatac ctttttcttg       480
     gtgattatgt ggacagaggt tattttagta tagagtgtgt cttatattta tgggtcttga       540
     agattctata cccaagcaca ttattccttc tgagaggcaa ccatgaatgc agacacctta       600
     ctgaatattt tacctttaag caggaatgta aaattaaata ttcagaaaga gtctatgaag       660
     cttgtatgga ggcttttgac agcttgcccc ttgctgcact tctaaaccaa caatttcttt       720
     gtgttcatgg tggactttca ccagaaatac acacactgga tgatattagg agattagata       780
     gatttaaaga gccacctgca tttggaccaa tgtgtgactt gctatggtct gatccttctg       840
     aagactttgg aaatgaaaaa tcacaagaac attttagtca taatacagtt cgaggatgtt       900
     cttattttta taactatcca gcagtgtgtg aatttttgca aaacaataat ttgttatcga       960
     ttattagagc tcatgaagct caagatgcag gctatagaat gtacagaaaa agtcaaacta      1020
     cagggtttcc ttcattaata acaatttttt cggcacctaa ttacttagat gtctacaata      1080
     ataaagctgc tgtactaaag tatgaaaata atgtgatgaa cattcgacag tttaattgct      1140
     ctccacatcc ttattggttg cccaatttta tggatgtctt tacatggtct ttaccatttg      1200
     ttggagaaaa agtgacagaa atgttggtaa atgttctgag tatttgttct gatgatgaac      1260
     taatgacaga aggtgaagac cagtttgatg taggttcagc tgcagcccgg aaagaaatca      1320
     taagaaacaa gatccgagca attggcaaga tggcaagagt cttctctgtt ctcagggagg      1380
     agagtgaaag cgtgctgaca ctcaagggcc tgactcccac agggatgttg cctagtggag      1440
     tgttggctgg aggacggcag accttgcaaa gtgccacagt tgaggctatt gaggctgaaa      1500
     aagcaatacg aggattctct ccaccacata gaatctgcag ttttgaagag gcaaagggtt      1560
     tggataggat caatgagaga atgccacccc ggaaagatgc tgtgcagcaa gatggtttca      1620
     attccctgaa caccgcacat accactgaga accacgggac tggcaaccat agtgcccagt      1680
     gaccagcggc ttcccaggga ctctcacatc ttgggcccca aatggacaga tcacttcaag      1740
     gagctggagg ggttgaccaa ggtgatgata aatgtcataa tctctctgaa gaaaccattg      1800
     tgctttctga gatccgtgcc ccccttcctg gatggaggct tgagggccct gggacttgtg      1860
     ccgtctataa gattgggtaa tcgctgccac agaggagagc agtgagcaag gggcttgggg      1920
     caatttccag tggaggatat ctacacctcc atttatgctt gtggttcaca catttacgtt      1980
     tacaaatgag atttcctttg tttttcccct cagtagaatt agacattttt caaccatgac      2040
     tttaaataca atctttagag ataacgtgga actcccccca tcaccctcac cccatgaaat      2100
     gtctttaaaa ggatggatta gcatggtctt aaaatatatt tctgaggtta ctagatgtat      2160
     tttgacttgt agacaaaatc tgagaaaccc agttggtgtt tatataaaat gctgacctca      2220
     ggttatagtt cttaaatgtg gctaattctg taacatagtc ttggtatttt tcaattatga      2280
     atgcataaac tatttctaag aagactctta cttgaacaaa atccaaaaac caatttagat      2340
     tcttttttgc ccatatcttt tgtgatttac accccagaga tttaaggaaa aaacaaaaac      2400
     aaaacaaaat gaaattttaa aattatgaag aattacagaa ttactcattt aaggtacttt      2460
     aaaagaagtt tgtacattgt caaagtaaat tttaattcaa atcatgtctg taaaacttga      2520
     cgtattttgt gtatgcatgt tttcattttg caaatattta atatatagac ctatgatgta      2580
     caggtacaac atgtataggt tacgtagata ttatgagaaa ttttagttta ttgtgagtac      2640
     tccagttgct ttaaaaacca ccagggtgat ttgctgctgg ctttgtatca tctttatgtt      2700
     taaatgcaaa ggaaattaaa aatgtctgga aatgtttttg actaagtaat gcagcctaga      2760
     agcaatggtt ctcttcaacc cttcagatgt ctagtggaag cataaaagtc aagactgcat      2820
     gtcgaaattt tacttttgat agttacagaa ctgcttggtt aaactaaatg gaaccatgtg      2880
     ctaattttac agtgactgac ctgtactgat taccactgta gtttggtatt tccctttact      2940
     ttggtggcct gcttccctca tgccctggag tacagctcat agcaccaggc agcggaacca      3000
     tctgttgttt tgtttgccag aaagtgcagc ctgtatggtc ttctgtctaa gttggaaata      3060
     ttatgcatgt gcaggactat tcaagtattt tataaacagt agcacacaat aaattccatg      3120
     catgggcaaa aaaaaaaaaa aaaaaaaaaa aaaaaaaaaa aaaaaaaaaa aaa             3173
//

If you have problems or comments...

PBIL Back to PBIL home page