(data stored in ACNUC22857 zone)

EMBL: BC066566

ID   BC066566; SV 1; linear; mRNA; STD; VRT; 4107 BP.
XX
AC   BC066566;
XX
DT   14-APR-2004 (Rel. 79, Created)
DT   16-JUL-2006 (Rel. 88, Last updated, Version 12)
XX
DE   Danio rerio adaptor-related protein complex 2, beta 1 subunit, mRNA (cDNA
DE   clone MGC:76931 IMAGE:6524686), complete cds.
XX
KW   MGC.
XX
OS   Danio rerio (zebrafish)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
OC   Actinopterygii; Neopterygii; Teleostei; Ostariophysi; Cypriniformes;
OC   Cyprinidae; Danio.
XX
RN   [1]
RP   1-4107
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-4107
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (13-FEB-2004) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; b7bae6111a5ed8ee8833872d1fe331b6.
DR   Ensembl-Gn; ENSDARG00000035152; danio_rerio.
DR   Ensembl-Tr; ENSDART00000171248; danio_rerio.
DR   Ensembl-Tr; ENSDART00000188878; danio_rerio.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Leonard I. Zon, M.D.
CC   cDNA Library Preparation: Invitrogen Corp
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: National Institutes of Health Intramural
CC   Sequencing Center (NISC),
CC   Gaithersburg, Maryland;
CC   Web site: http://www.nisc.nih.gov/
CC   Contact: nisc_mgc@nhgri.nih.gov
CC   Akhter,N., Ayele,K., Beckstrom-Sternberg,S.M., Benjamin,B.,
CC   Blakesley,R.W., Bouffard,G.G., Breen,K., Brinkley,C., Brooks,S.,
CC   Dietrich,N.L., Granite,S., Guan,X., Gupta,J., Haghighi,P.,
CC   Hansen,N., Ho,S.-L., Karlins,E., Kwong,P., Laric,P., Legaspi,R.,
CC   Maduro,Q.L., Masiello,C., Maskeri,B., Mastrian,S.D.,McCloskey,J.C.,
CC   McDowell,J., Pearson,R., Stantripop,S., Thomas,P.J., Touchman,J.W.,
CC   Tsurgeon,C., Vogt,J.L., Walker,M.A., Wetherby,K.D., Wiggins,L.,
CC   Young,A., Zhang,L.-H. and Green,E.D.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAK Plate: 145 Row: e Column: 22
CC   This clone was selected for full length sequencing because it
CC   passed the following selection criteria: matched mRNA gi: 46559755.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..4107
FT                   /organism="Danio rerio"
FT                   /lab_host="DH10B"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NCI_CGAP_ZKid1"
FT                   /clone="MGC:76931 IMAGE:6524686"
FT                   /tissue_type="Kidney, zebrafish"
FT                   /note="Vector: pCMV-SPORT6.1"
FT                   /db_xref="taxon:7955"
FT   gene            1..4107
FT                   /gene="ap2b1"
FT                   /note="synonyms: fa16e07, zgc:55659, wu:fa16c06,
FT                   wu:fc18c08, wu:fa16e07"
FT   CDS_pept        119..2974
FT                   /codon_start=1
FT                   /gene="ap2b1"
FT                   /product="adaptor-related protein complex 2, beta 1
FT                   subunit"
FT                   /db_xref="GOA:Q6NYJ9"
FT                   /db_xref="InterPro:IPR000225"
FT                   /db_xref="InterPro:IPR002553"
FT                   /db_xref="InterPro:IPR008152"
FT                   /db_xref="InterPro:IPR009028"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR012295"
FT                   /db_xref="InterPro:IPR013037"
FT                   /db_xref="InterPro:IPR013041"
FT                   /db_xref="InterPro:IPR015151"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR016342"
FT                   /db_xref="InterPro:IPR026739"
FT                   /db_xref="UniProtKB/TrEMBL:Q6NYJ9"
FT                   /db_xref="ZFIN:ZDB-GENE-030131-6564"
FT                   /protein_id="AAH66566.1"
FT                   /translation="MTDSKYFTTNKKGEIFELKAELNNEKKEKRKEAVKKVIAAMTVGK
FT                   DVSSLFPDVVNCMQTDNLELKKLVYLYLMNYAKSQPDMAIMAVNSFVKDCEDPNPLIRA
FT                   LAVRTMGCIRVDKITEYLCEPLRKCLKDEDPYVRKTAAVCVAKLHDINAQMVEDQGFLD
FT                   SLRDLIADSNPMVVANAVAALSEISESHPNSNLLDLNPQNINKLLTALNECTEWGQIFI
FT                   LDCLSNYNPKDEREAQSICERVTPRLSHANSAVVLSAVKVLMKFLELLPKDSDYYNTLL
FT                   KKLSPPLVTLLSGEPEVQYVALRNINLIVQKRPEILKQEIKVFFVKYNDPIYVKLEKLD
FT                   IMIRLASHANIAQVLAELKEYATEVDVDFVRKAVRAIGRCAIKVEQSAERCVSTLLDLI
FT                   QTKVNYVVQEAIVVIRDIFRKYPNKYESIIATLCENLDSLDEPDARGAMIWIVGEYAER
FT                   IDNADELLESFLEGFHDESTQVQLTLLTAIVKLFLKKPSETQELVQQVLSLATQDSDNP
FT                   DLRDRGYIYWRLLSTDPVTAKEVVLSEKPLISEETDLIEPTLLDELICHIGSLASVYHK
FT                   PPNAFVEGSHGIHRKHLPIQHGSIDTGESPVSTGPAASIDQPQVIPSQGDLLGDLLNLD
FT                   LGPPVNVPQVSSMQIAAVDLLGGGLDSLLGGDLGGGVGGSPAVGQNFIPSSVPNTFAPS
FT                   PTPAALSSGLNDLFELSTGMATATGGYVAAKTVWLPAVKAKGLEISGTFSRRQGHMYMD
FT                   MTFTNKALQHMTDFAIQFNKNSFGVIPTTPLPVHTPLMPSQSIDISLPLNTIGPVMKMD
FT                   PLNNLQVAVKNNIDVFYFSTLIPLNVFFVEDGKMERQVFLATWKDIPNENELQYQIKDC
FT                   HLNADTVSGKLQSNNVYTIAKRNVEGQDMLYQSLKLTNGIWILAELRIQPGNPNYTLSL
FT                   KCRAPEVSQYVYQMYDATLKN"
XX
SQ   Sequence 4107 BP; 1078 A; 1024 C; 952 G; 1053 T; 0 other;
     ccgagctgtg ccaacaaccg catcttccat ctcctcgttg ggaagtgctg caataaccac        60
     acatctgtac atcccgcgtc gattcttaca tcgcttgtcc atttgagaag ctgtcagaat       120
     gactgactca aagtatttca ccaccaacaa aaaaggagaa atctttgagc tgaaggccga       180
     gctgaataat gagaagaagg agaagaggaa agaggcagtg aagaaagtca tcgccgccat       240
     gacggtgggc aaggatgtca gttcgttgtt tccagatgtg gtgaactgca tgcagacgga       300
     caacctggag ctgaagaagc tggtttacct gtaccttatg aattatgcca agagtcagcc       360
     ggacatggcc atcatggcag ttaacagctt tgtcaaggac tgtgaggatc caaaccctct       420
     gatccgtgct ctggctgtgc gcacgatggg ttgtatccgc gtggacaaga tcactgagta       480
     cctctgtgaa cctctgcgaa agtgtctgaa ggatgaagac ccgtacgtga ggaagactgc       540
     agccgtgtgt gtggccaaac tgcatgacat caatgctcag atggtggagg accagggctt       600
     cctggactct ctccgggacc tgatcgctga ctccaatccc atggttgtgg ccaatgcagt       660
     tgctgctctg tctgagatca gcgagtctca ccccaacagc aaccttctgg acctgaaccc       720
     tcagaacatc aacaagcttc tgacggctct taatgagtgc actgaatggg gccagatctt       780
     catcctggac tgcctctcca actacaaccc caaagacgag cgggaggccc agagtatctg       840
     tgagcgggtg acgccacgtc tctcgcatgc taattcagct gtggtgcttt cggcggtaaa       900
     ggtactgatg aagtttttgg agctcctgcc caaagactct gattactaca acactcttct       960
     gaagaagctc tctcctcccc tcgtcacact gttatctggc gaaccagagg tccaatatgt      1020
     ggcgctcagg aatatcaacc ttattgtgca gaaacggcct gagattttga agcaagagat      1080
     taaagtgttc tttgtcaagt acaatgaccc tatatatgtc aagttggaga aactggacat      1140
     catgatccga ctagcctctc atgccaacat cgcccaggtc ctggctgagc tgaaggaata      1200
     tgccactgag gtggatgtag actttgttcg gaaagccgtg cgagccattg gtcgctgtgc      1260
     catcaaagtg gagcaatccg ctgagcgctg tgttagcacc ctgctggacc ttatccagac      1320
     caaagtcaac tacgtcgtgc aggaagccat tgtggtcatc agggacatct tccgcaaata      1380
     tcccaacaag tatgagagca taatcgccac tctgtgtgaa aacctggact ctctggatga      1440
     acctgacgct cgaggagcca tgatctggat tgttggcgaa tatgcagagc gtatcgacaa      1500
     cgctgatgag ctactggaga gtttcctcga gggcttccat gatgaaagca ctcaggtcca      1560
     gttgactctg ctgacagcca tagtgaagct gttcctgaag aagccctctg agactcagga      1620
     gctggttcag caggtgctca gtctggccac tcaggactct gataaccctg acctgcgtga      1680
     ccgcggctac atctactggc gtctgctgtc cactgatcct gtcaccgcta aagaggtggt      1740
     gctgtctgag aaacctctga tctcagagga gacggacctg attgagccca ccctgctgga      1800
     cgagctcatc tgccacattg gctcgctggc ctcagtctac cacaagcccc caaatgcctt      1860
     tgtggaggga agccatggca ttcatcgcaa acatctgccc atccagcacg gcagtatcga      1920
     caccggggag agtcccgtca gtaccggccc ggctgcttcc attgatcaac cccaggtcat      1980
     cccatctcag ggtgaccttc tgggagacct gcttaatctg gacctcgggc caccggtcaa      2040
     tgtgccccag gtgtcctcca tgcagatagc ggctgtggat ctcctgggag gtggtcttga      2100
     cagtttgctc gggggagatc tgggaggagg tgttgggggc agtcctgcag tgggccagaa      2160
     cttcatccca tcatcggtgc ccaacacctt tgcaccatct ccgacacctg ccgctcttag      2220
     cagcggactc aatgacctgt ttgagttgtc cacaggaatg gccactgcta caggaggata      2280
     tgtggctgct aaaactgtgt ggctgccagc agtcaaggcc aaaggactgg agatttctgg      2340
     aaccttctct cggcgtcaag ggcacatgta tatggacatg accttcacca ataaagcatt      2400
     gcagcatatg actgactttg ccatccagtt caacaagaac agttttggtg taatccccac      2460
     cacacctctc cccgtccaca ctccactgat gcccagtcag agcatcgaca tctccctccc      2520
     gctcaacacc atcggccctg tgatgaaaat ggatccactc aacaacctac aggtggccgt      2580
     gaaaaacaat attgatgtct tctactttag cacgctgatc cctctcaatg tcttcttcgt      2640
     ggaggatggc aaaatggagc gtcaggtgtt cttggccaca tggaaggaca ttcctaatga      2700
     gaatgagctg caataccaga tcaaagactg ccacttaaac gcagatacgg tgtcgggcaa      2760
     actgcagagc aacaatgtct acaccatcgc aaagaggaac gtggaaggcc aggacatgtt      2820
     gtaccagtcg ctcaaactca ccaacgggat ctggattctc gccgagctcc gcatacaacc      2880
     cggcaatccc aattacacgc tgtctctgaa gtgcagggct ccagaggttt ctcagtacgt      2940
     gtaccagatg tacgatgcca ctctgaagaa ctgagcgtct ctcttgtcct ttttcttcct      3000
     ctacacacac ctcttcttcc ccagccgccg ccaccaccgg catagaatcc tgctctccaa      3060
     tgattttctg ccgttgtttt ccatccatag gtaccagttt tactcgatgt gccctgcaaa      3120
     gttctgttct tgccaaatgt ctcgatgtgg ttgaaaaaaa gtggggattt ggcaacacag      3180
     ttcccatgtg atttctatcg ttcttttcaa ttgtttgaat gcgttcacct tcacatgcca      3240
     ttatcatgta cgaacaggaa aaaaacgtgc gtggaatatt tagaaacgta atgcgagtgt      3300
     attttcattt caagagcact atatcccgat gttagccaaa atgaaaacgc ttaatagtac      3360
     atgctaacta tctgatagta gcctcgcatg ctttttgacc aacataaaaa aatatcacat      3420
     tccttttttt aacatttcgt gtaatcgttc accaacatgt caacactcca tcaacgtctc      3480
     cgatggtttc aactgctata aatcaaccta acgtgaagca gaaaaccgac tttctatcaa      3540
     ttgatcttgt gtaagtgggt catctgatat tcattcccag attgagtcca ttcatttgtg      3600
     atatatcgtg cttgtgagat ttgtgcatta atattttagt ccctttggtg taacgttcta      3660
     cattaataca taaagcatcg ctcagctttt ggtttaaaac taatacacta atgtagggat      3720
     gcaatatatt ctaaatagac atcaataata tccgatgaaa tagatggatc actttattag      3780
     tctttcaggt ggtgctggtg atttaaatgt gaatgttttg ttgctaatgt gcctgtgtga      3840
     acctgcatgt gagcagcgtc taataaacat ctgccagtag aacccttgtg taataaggtg      3900
     gagtattaat agggtaacct ttatatgtgc aaaatgttga gttttaatga aaaacatttc      3960
     tattgtcagt cagatcatcc tggtattgaa atgcaacaaa aaaataaagt ctgataattt      4020
     tttccatgat ttattttatg gatcgttatg attccgaata aagtcagcag tgttggcctc      4080
     cccaaaaaaa aaaaaaaaaa aaaaaaa                                          4107
//

If you have problems or comments...

PBIL Back to PBIL home page