(data stored in ACNUC8465 zone)

EMBL: BC066954

ID   BC066954; SV 1; linear; mRNA; STD; HUM; 2378 BP.
XX
AC   BC066954;
XX
DT   04-MAR-2004 (Rel. 79, Created)
DT   15-OCT-2008 (Rel. 97, Last updated, Version 10)
XX
DE   Homo sapiens ras homolog gene family, member B, mRNA (cDNA clone MGC:87422
DE   IMAGE:5264057), complete cds.
XX
KW   MGC.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-2378
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-2378
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (01-MAR-2004) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; a7c74630606cf4f680eb3bd3eb3495bc.
DR   Ensembl-Gn; ENSG00000143878; homo_sapiens.
DR   Ensembl-Tr; ENST00000272233; homo_sapiens.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Miklos Palkovits, M.D., Ph.D.
CC   cDNA Library Preparation: Michael J. Brownstein (NHGRI) &  Shiraki
CC   Toshiyuki and Piero Carninci (RIKEN)
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: Sequencing Group at the Stanford Human Genome
CC   Center, Stanford University School of Medicine, Stanford, CA  94305
CC   Web site:       http://www-shgc.stanford.edu
CC   Contact:  (Dickson, Mark) mcd@paxil.stanford.edu
CC   Dickson, M., Schmutz, J., Grimwood, J., Rodriquez, A., and Myers,
CC   R. M.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAK Plate: 167 Row: k Column: 5
CC   This clone was selected for full length sequencing because it
CC   passed the following selection criteria: matched mRNA gi: 42716309.
CC   Differences found between this sequence and the human reference
CC   genome (build 36) are described in misc_difference features below.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2378
FT                   /organism="Homo sapiens"
FT                   /lab_host="DH10B"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NIH_MGC_95"
FT                   /clone="MGC:87422 IMAGE:5264057"
FT                   /tissue_type="Brain, hippocampus"
FT                   /note="Vector: pBluescriptR"
FT                   /db_xref="taxon:9606"
FT   gene            1..2378
FT                   /gene="RHOB"
FT                   /note="synonym: RHOH6"
FT   CDS_pept        393..983
FT                   /codon_start=1
FT                   /gene="RHOB"
FT                   /product="ras homolog gene family, member B"
FT                   /db_xref="GOA:P62745"
FT                   /db_xref="H-InvDB:HIT000262374.13"
FT                   /db_xref="HGNC:HGNC:668"
FT                   /db_xref="InterPro:IPR001806"
FT                   /db_xref="InterPro:IPR003578"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="PDB:2FV8"
FT                   /db_xref="UniProtKB/Swiss-Prot:P62745"
FT                   /protein_id="AAH66954.1"
FT                   /translation="MAAIRKKLVVVGDGACGKTCLLIVFSKDEFPEVYVPTVFENYVAD
FT                   IEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSVDSPDSLENIPEKWVPEVK
FT                   HFCPNVPIILVANKKDLRSDEHVRTELARMKQEPVRTDDGRAMAVRIQAYDYLECSAKT
FT                   KEGVREVFETATRAALQKRYGSQNGCINCCKVL"
FT   misc_difference 1186
FT                   /gene="RHOB"
FT                   /note="'C' in cDNA is 'G' in the human genome."
FT   misc_difference 1323
FT                   /gene="RHOB"
FT                   /note="'A' in cDNA is 'G' in the human genome."
FT   misc_difference 2364..2378
FT                   /gene="RHOB"
FT                   /note="polyA tail: 15 bases do not align to the human
FT                   genome."
XX
SQ   Sequence 2378 BP; 494 A; 685 C; 674 G; 525 T; 0 other;
     atctgccacc gcagtctggt tggagctgtt gtcttgtatg ctcagcgagg cccggagaga        60
     cccgggagag agctaggccg agtccaccgc ccgagtctgc tgcccgagcc cgcgttacgc       120
     acaaagccgc cgatccccgg cctggggtga gcagagcgac caccgcccgg gagcagcgcg       180
     gcgagacgca cggtgcgccc tatgcccccg cgcccccacc gcccccgccg cggcagccga       240
     agcgcagcga gagaacgcgc caccgcgggg cccgggtgca gctagcgacc ctctcgccac       300
     ctgcgcgcag cccgaggtga gcagtgagcg gcgagcggga gggcagcgag gcgttcgcgg       360
     gccccctcct gctgcccggg cccggcccgc tcatggcggc catccgcaag aagctggtgg       420
     tggtgggcga cggcgcgtgt ggcaagacgt gcctgctgat cgtgttcagt aaggacgagt       480
     tccccgaggt gtacgtgccc accgtcttcg agaactatgt ggccgacatt gaggtggacg       540
     gcaagcaggt ggagctggcg ctgtgggaca cggcgggcca ggaggactac gaccgcctgc       600
     ggccgctctc ctacccggac accgacgtca ttctcatgtg cttctcggtg gacagcccgg       660
     actcgctgga gaacatcccc gagaagtggg tccccgaggt gaagcacttc tgtcccaatg       720
     tgcccatcat cctggtggcc aacaaaaaag acctgcgcag cgacgagcat gtccgcacag       780
     agctggcccg catgaagcag gaacccgtgc gcacggatga cggccgcgcc atggccgtgc       840
     gcatccaagc ctacgactac ctcgagtgct ctgccaagac caaggaaggc gtgcgcgagg       900
     tcttcgagac ggccacgcgc gccgcgctgc agaagcgcta cggctcccag aacggctgca       960
     tcaactgctg caaggtgcta tgagggccgc gcccgtcgcg cctgcccctg ccggcacggc      1020
     tccccctcct ggaccagtcc cccgcgagcc cggagaaggg gagacccgtg tcccacaagg      1080
     accccaccgg cctgcctggc atctgtctgc tgacgcctct ggcttgcgcc aggacttggc      1140
     gtgggcaccg ggcgccccca tcccagtgtc tgtgtgcgtc cagctctgtt gcacaggcct      1200
     gggctcccca ctgagtgcca agggtcccct gagcatgctt ttctgaagag ccgggcctca      1260
     gagtgtgtgg ctgtgtgtct gttcgactcc cctcgcccca ttttcacccc acccccgcct      1320
     ctaatccccg ggggcgagat tggcgcggga gtgtggccgc gccccatcag atgttcgccc      1380
     ttcaccagcg ggagcttgat atcccttgtc tgtaacatag accccgggta ctgcgggagg      1440
     ggagggctgc tggggaggat ggggggatgt tatataaata tagatataat tttattttcg      1500
     gagctaagat ggtgttattt aagggtggtg atgggtgagc gctctggccc aggctgggcc      1560
     agactcccgc ccaagcatga acaggacttg accatctttc caacccctgg ggaagacatt      1620
     tgcaactgac ttggggagga cacagcttca gcacagcctc tcctgcgggc cagcccgctg      1680
     cgaaccctcc accagctacc ggagggagga gggaggatgc gctgtggggt tgtttttgcc      1740
     ataagcgaac tttgtgcctg tcctagaagt gaaaattgtt cagtccaaga aactgatgtt      1800
     atttgattta tttaaaggct aaaatttgtt tttttattct ttgcacaatt gtttcattgt      1860
     ttgacactta atgcactcgt catttgcata cgacagtagc attctgacca cacttgtacg      1920
     ctgtaacctc atctacttct gatgttttta aaaaatgact tttaacaagg agagggaaaa      1980
     gaaacccact aaattttgct ttgtttcctt gaagaatgtg gcaacactgt tttgtgattt      2040
     tatttgtgca ggtcatgcac acagttttga taaagggcag taacaagtat tggggcctat      2100
     tttttttttt tccacaaggc attctctaaa gctatgtgaa attttctctg cacctctgta      2160
     cagagaatac acctgcccct gtatatcctt ttttcccctc ccctccctcc cagtggtact      2220
     tctactaaat tgttgtcttg ttttttattt tttaaataaa ctgacaaatg acaaaatggt      2280
     gagcttatga tgtttacata aaagttctat aagctgtgta tacagttttt tatgtaaaat      2340
     attaaaagac tatgatgatg acaaaaaaaa aaaaaaaa                              2378
//

If you have problems or comments...

PBIL Back to PBIL home page