(data stored in ACNUC8465 zone)

EMBL: BC068390

ID   BC068390; SV 1; linear; mRNA; STD; VRT; 2219 BP.
XX
AC   BC068390;
XX
DT   10-APR-2004 (Rel. 79, Created)
DT   21-OCT-2008 (Rel. 97, Last updated, Version 8)
XX
DE   Danio rerio ras homolog gene family, member Aa, mRNA (cDNA clone MGC:85805
DE   IMAGE:6961626), complete cds.
XX
KW   MGC.
XX
OS   Danio rerio (zebrafish)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
OC   Actinopterygii; Neopterygii; Teleostei; Ostariophysi; Cypriniformes;
OC   Cyprinidae; Danio.
XX
RN   [1]
RP   1-2219
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-2219
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (02-APR-2004) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; f0dee936cbcbe9f97f96d8fedd41820a.
DR   Ensembl-Gn; ENSDARG00000026845; danio_rerio.
DR   Ensembl-Tr; ENSDART00000040645; danio_rerio.
DR   Ensembl-Tr; ENSDART00000177931; danio_rerio.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Leonard I. Zon, M.D.
CC   cDNA Library Preparation: Invitrogen Corp
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: Sequencing Group at the Stanford Human Genome
CC   Center, Stanford University School of Medicine, Stanford, CA  94305
CC   Web site:       http://www-shgc.stanford.edu
CC   Contact:  (Dickson, Mark) mcd@paxil.stanford.edu
CC   Dickson, M., Schmutz, J., Grimwood, J., Rodriquez, A., and Myers,
CC   R. M.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAK Plate: 165 Row: h Column: 8
CC   This clone was selected for full length sequencing because it
CC   passed the following selection criteria: matched mRNA gi: 46329680.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2219
FT                   /organism="Danio rerio"
FT                   /lab_host="DH10B"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NCI_CGAP_ZKid1"
FT                   /clone="MGC:85805 IMAGE:6961626"
FT                   /tissue_type="Kidney, zebrafish"
FT                   /note="Vector: pCMV-SPORT6.1"
FT                   /db_xref="taxon:7955"
FT   gene            1..2219
FT                   /gene="rhoaa"
FT                   /note="synonyms: zgc:85805, wu:fa66g04, wu:fb26g07,
FT                   fb26g07, fa66g04, Rhoa, zgc:66058"
FT   CDS_pept        38..619
FT                   /codon_start=1
FT                   /gene="rhoaa"
FT                   /product="ras homolog gene family, member Aa"
FT                   /db_xref="GOA:Q6NUX8"
FT                   /db_xref="InterPro:IPR001806"
FT                   /db_xref="InterPro:IPR003578"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6NUX8"
FT                   /db_xref="ZFIN:ZDB-GENE-040426-2150"
FT                   /protein_id="AAH68390.1"
FT                   /translation="MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVAD
FT                   IEVDSKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVK
FT                   HFCPNVPIILVGNKKDLRNDEHTRRELQKMKQEPVKPEEGRDMANRINAFGYLECSAKT
FT                   KEGVREVFEMATRAALQAKKRGKKNACALL"
XX
SQ   Sequence 2219 BP; 723 A; 389 C; 464 G; 643 T; 0 other;
     aaagataaag aaagcgagga catctgaaac gaaaacgatg gctgcgattc gtaagaagct        60
     tgtaatcgtt ggagatggag cctgtggaaa gacgtgttta ctcatcgttt tcagtaaaga       120
     ccagtttcct gaggtttacg ttcccacagt gtttgagaac tatgtcgctg atattgaggt       180
     ggattcaaaa caggtggaac tggctctatg ggatacagct ggccaagagg actacgacag       240
     gctgaggccc ctgtcctacc cagacactga tgtcatcctt atgtgctttt ccatagacag       300
     tcctgacagt ttggagaaca tcccagagaa atggacgcca gaagtaaaac atttctgccc       360
     taatgttcca ataatactgg tgggtaataa aaaagattta cggaatgacg agcacactcg       420
     acgggagctg cagaagatga aacaggaacc agttaaacca gaggagggac gagacatggc       480
     taatcgcatc aatgccttcg gctaccttga gtgttcagct aaaactaagg agggcgtgag       540
     ggaagtgttt gaaatggcca caagagcggc gctccaagcc aagaaacgtg gcaagaagaa       600
     tgcctgcgct ttgctataga gaacacaagt ggaaaatgag aagaacgagg gagggaaaag       660
     gggtaaccaa acacggccaa ggaaaatgaa agagctctaa aagttcgcaa atagagggaa       720
     gaaacagccc ctagtgttaa ttatgtactc gggggttcag ggagggtcat tttcaatcca       780
     ggccaaaaga aactacagaa gatagtaggg acagctgcac cggcaaacaa aagggactta       840
     aacatttcac aaaaggccat cagtcctctt tcaaatcaag attagttgac cttaaagcct       900
     tcagactgat tgatcacgga gcaaggatag cgtatttgta gagtaaagat tgacgtgggt       960
     tcacagtgat tgcgttcgag gtgggattaa atgccatgta ttctttggcc cctttgatta      1020
     gaagatcagc actgtaagca agaacttggt ctaaaaaaaa tagattcctt ttttggcagt      1080
     aaatgcatta ttcagggtgt aaaaggcatt agttactacc ctacatcgct tatgctacat      1140
     gtcaagcggg gagttgtttt tttggatcaa gacattggcg cacaatgtaa tactctagtt      1200
     gactacctta gaaacctccc aggaacccag tgccgtctta tgtaaaacat tcatgactga      1260
     ttttctgata tatatacatt tttttcttgc attaacacgc taatactgtt tgataacaca      1320
     actggttcct ctgtgccctc ctgtcctgtc gcagaatcga cggtttaatc gctggtttaa      1380
     agtagctgaa agtagtagta gtcttacaat tctttattcc agttaagtat atcttgtact      1440
     ttgttgccat ttgcctataa aattctaagt aagatgcatt aagcaatgat catactaatt      1500
     cacctttttg tgagtatttt atgtgcttgc tcatgtattg taattaaaaa aaagaacaaa      1560
     aaaacaaaaa caattttggg ttaatcagcc ttcgtggagc tccaagcaga actgcagctc      1620
     tgtatgttga ctgtcagaca ctgtttgatt ttggctatat atatatttat atatatagat      1680
     acgtttttat cataggtgac agtaatgtaa tttaccccgt attactcttt gcctgcatga      1740
     caggctttta tttggtgtgc agaaatcaaa tatatgttta tctcactgta taaatgagaa      1800
     gctccctcca ttttcactcc atgtcttttt attattcccc tctttcttct ccagtactgt      1860
     gcatttttta tgtttttttg ttttgtgaaa ttctactggc ttatactata tcatttttgc      1920
     atattttaca aattctagta tcttagaatt gaattaaaga aggacaaaag atagtaaaaa      1980
     tgtgactgag agagagagag agctgtttaa tgccatatta ttatatgcaa gtcatttctt      2040
     agaagagatt ctgcatttca ttgtaagaga aaaagccttt gatgcgtcaa ttatcttttg      2100
     tataccagtg catctttgga tttccacaga ctcatttgaa ttgtactgaa aaaataaatt      2160
     cttatagggt aaaaaaaaaa aaaaaaaaaa aaaaaaaaaa aaaaaaaaaa aaaaaaaaa       2219
//

If you have problems or comments...

PBIL Back to PBIL home page