(data stored in ACNUC16935 zone)

EMBL: BC070919

ID   BC070919; SV 1; linear; mRNA; STD; ROD; 1170 BP.
XX
AC   BC070919;
XX
DT   20-MAY-2004 (Rel. 79, Created)
DT   12-JUN-2008 (Rel. 96, Last updated, Version 6)
XX
DE   Rattus norvegicus ubiquitin B, mRNA (cDNA clone MGC:91487 IMAGE:7104905),
DE   complete cds.
XX
KW   MGC.
XX
OS   Rattus norvegicus (Norway rat)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Rattus.
XX
RN   [1]
RP   1-1170
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-1170
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (17-MAY-2004) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; 510fdc6d5b72e2735fd1db6d36f63cc3.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Howard Jacobs
CC   cDNA Library Preparation: Express Genomics
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: National Institutes of Health Intramural
CC   Sequencing Center (NISC),
CC   Gaithersburg, Maryland;
CC   Web site: http://www.nisc.nih.gov/
CC   Contact: nisc_mgc@nhgri.nih.gov
CC   Akhter,N., Ayele,K., Beckstrom-Sternberg,S.M., Benjamin,B.,
CC   Blakesley,R.W., Bouffard,G.G., Breen,K., Brinkley,C., Brooks,S.,
CC   Dietrich,N.L., Granite,S., Guan,X., Gupta,J., Haghighi,P.,
CC   Hansen,N., Ho,S.-L., Karlins,E., Kwong,P., Laric,P., Legaspi,R.,
CC   Maduro,Q.L., Masiello,C., Maskeri,B., Mastrian,S.D.,McCloskey,J.C.,
CC   McDowell,J., Pearson,R., Stantripop,S., Thomas,P.J., Touchman,J.W.,
CC   Tsurgeon,C., Vogt,J.L., Walker,M.A., Wetherby,K.D., Wiggins,L.,
CC   Young,A., Zhang,L.-H. and Green,E.D.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAK Plate: 175 Row: o Column: 17
CC   This clone was selected for full length sequencing because it
CC   passed the following selection criteria: matched mRNA gi: 20302084.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1170
FT                   /organism="Rattus norvegicus"
FT                   /lab_host="DH10B"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NIH_MGC_233"
FT                   /clone="MGC:91487 IMAGE:7104905"
FT                   /tissue_type="Heart, rat (Brown Norway)"
FT                   /note="Vector: pExpress1"
FT                   /db_xref="taxon:10116"
FT   gene            1..1170
FT                   /gene="Ubb"
FT                   /note="synonym: UBC"
FT   CDS_pept        73..990
FT                   /codon_start=1
FT                   /gene="Ubb"
FT                   /product="ubiquitin B"
FT                   /db_xref="GOA:P0CG51"
FT                   /db_xref="InterPro:IPR000626"
FT                   /db_xref="InterPro:IPR019954"
FT                   /db_xref="InterPro:IPR019956"
FT                   /db_xref="InterPro:IPR029071"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0CG51"
FT                   /protein_id="AAH70919.1"
FT                   /translation="MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIF
FT                   AGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKA
FT                   KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGK
FT                   TITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV
FT                   LRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDG
FT                   RTLSDYNIQKESTLHLVLRLRGGY"
XX
SQ   Sequence 1170 BP; 325 A; 334 C; 295 G; 216 T; 0 other;
     gaggtctttc tgtgagggtg tttcgacgcg ctgggcggtt tgttccttca tcgcattcgt        60
     taacaggtca aaatgcaaat cttcgtgaag accctgaccg gcaagaccat caccctagag       120
     gtggagccca gtgacaccat cgagaacgtg aaggccaaga tccaggataa agagggcatc       180
     ccccctgacc agcagaggct catctttgcc ggcaagcagc tggaagatgg ccgcaccctc       240
     tctgactaca acatccagaa agagtcaacc ctgcacctgg tcctccgcct gaggggcggc       300
     atgcagatct tcgtgaagac cctgaccggc aagaccatca ccctggaggt ggagcccagt       360
     gacaccatcg agaacgtgaa ggccaagatc caggataaag agggcatccc ccctgaccag       420
     cagaggctca tctttgccgg caagcagctg gaagatggcc gcaccctctc tgattacaac       480
     atccagaaag agtcaaccct gcaccttgtc ctccgcctga ggggcggcat gcagatcttc       540
     gtgaagaccc tgaccggcaa gaccatcacc ctagaggtgg agcccagtga caccatcgag       600
     aacgtgaagg ccaagatcca ggataaagag ggcatccccc ctgaccagca gaggctcatc       660
     tttgccggca agcagctgga agatggccgc accctctctg actacaacat ccagaaggag       720
     tcaaccctgc acctggtcct ccgcctgagg ggcggcatgc agatcttcgt gaagaccctg       780
     accggcaaga ccatcaccct ggaggtggag cccagtgaca ccatcgagaa cgtgaaggcc       840
     aagatccagg ataaagaggg catcccccct gaccagcaga ggctcatctt tgccggcaag       900
     cagctggaag atggccgcac cctctctgat tacaacatcc agaaagagtc aaccctgcac       960
     ctggtcctcc gcctgagggg tggctattaa ttcttcagtc tgcattcccg gcgggcactg      1020
     atggcattac tctgcactct agccatttgc cccaatttaa gtttagaaat tacaagtttc      1080
     agtaatagct gaacctctgt taaaaatgtt aataaaggtt ttgttgcatg gtaagcaaaa      1140
     aaaaaaaaaa aaaaaaaaaa aaaaaaaaaa                                       1170
//

If you have problems or comments...

PBIL Back to PBIL home page