(data stored in ACNUC1944 zone)

EMBL: BC074048

ID   BC074048; SV 1; linear; mRNA; STD; VRT; 1405 BP.
XX
AC   BC074048;
XX
DT   29-JUN-2004 (Rel. 80, Created)
DT   21-OCT-2008 (Rel. 97, Last updated, Version 8)
XX
DE   Danio rerio mitochondrial ribosome recycling factor, mRNA (cDNA clone
DE   MGC:91914 IMAGE:7040085), complete cds.
XX
KW   MGC.
XX
OS   Danio rerio (zebrafish)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
OC   Actinopterygii; Neopterygii; Teleostei; Ostariophysi; Cypriniformes;
OC   Cyprinidae; Danio.
XX
RN   [1]
RP   1-1405
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-1405
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (23-JUN-2004) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; dcad4f78bde0c559bab18547bb49c410.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Len Zon, Harvard
CC   cDNA Library Preparation: Open Biosystems
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: National Institutes of Health Intramural
CC   Sequencing Center (NISC),
CC   Gaithersburg, Maryland;
CC   Web site: http://www.nisc.nih.gov/
CC   Contact: nisc_mgc@nhgri.nih.gov
CC   Akhter,N., Ayele,K., Beckstrom-Sternberg,S.M., Benjamin,B.,
CC   Blakesley,R.W., Bouffard,G.G., Breen,K., Brinkley,C., Brooks,S.,
CC   Dietrich,N.L., Granite,S., Guan,X., Gupta,J., Haghighi,P.,
CC   Hansen,N., Ho,S.-L., Karlins,E., Kwong,P., Laric,P., Legaspi,R.,
CC   Maduro,Q.L., Masiello,C., Maskeri,B., Mastrian,S.D.,McCloskey,J.C.,
CC   McDowell,J., Pearson,R., Stantripop,S., Thomas,P.J., Touchman,J.W.,
CC   Tsurgeon,C., Vogt,J.L., Walker,M.A., Wetherby,K.D., Wiggins,L.,
CC   Young,A., Zhang,L.-H. and Green,E.D.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAK Plate: 178 Row: i Column: 7
CC   This clone was selected for full length sequencing because it
CC   passed the following selection criteria: matched mRNA gi: 49256674.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1405
FT                   /organism="Danio rerio"
FT                   /lab_host="DH10B"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NIH_ZGC_7"
FT                   /clone="MGC:91914 IMAGE:7040085"
FT                   /tissue_type="Whole, adult zebrafish"
FT                   /note="Vector: pExpress1"
FT                   /db_xref="taxon:7955"
FT   gene            1..1405
FT                   /gene="mrrf"
FT                   /note="synonym: zgc:91914"
FT   CDS_pept        128..901
FT                   /codon_start=1
FT                   /gene="mrrf"
FT                   /product="mitochondrial ribosome recycling factor"
FT                   /db_xref="GOA:Q6GMJ7"
FT                   /db_xref="InterPro:IPR002661"
FT                   /db_xref="InterPro:IPR023584"
FT                   /db_xref="InterPro:IPR036191"
FT                   /db_xref="UniProtKB/TrEMBL:Q6GMJ7"
FT                   /db_xref="ZFIN:ZDB-GENE-040704-12"
FT                   /protein_id="AAH74048.1"
FT                   /translation="MALSHLNLLRPVLYRSLPSVFRIPRLTSSRVSFLPQVSQCPVALP
FT                   NYARHYATKKSKAKAKGQTAKVNINAALVEDIISLEEVKEDMAAVLAALKDDFSRNLSV
FT                   RTSPGALDHITVTTKDGKFPLNQLGQISMKSPQLLVVNMTGFPEAMVAVTRALRESSMG
FT                   LNPEVEGTIIRVPVPKVTREHRENLVKLAKQFSNKSKDSLRRVRSNAISQVKKSKDAVS
FT                   DDTIHLIEKQIQQMTDSFTADIDKQLATKTKELLG"
XX
SQ   Sequence 1405 BP; 435 A; 318 C; 317 G; 335 T; 0 other;
     caaaaaggga ctgtaatgca aggcatgctt gctaagatat ttttttctgc atgagagtga        60
     atttaaaagc gccccctggt ggcactatta aacttcatcc aatctccaaa gtctagttac       120
     cacagacatg gccttgagtc atctgaacct cctgcggcca gtattgtacc gatctctgcc       180
     atcagttttt aggatcccac gactgaccag ttcaagagtc tcctttctgc ctcaagtgag       240
     ccagtgtccc gtggctctgc cgaattacgc ccgtcattat gccacaaaga agagtaaagc       300
     aaaggcaaaa gggcagacag ctaaagtgaa catcaatgca gctttggtgg aggatattat       360
     cagcctggag gaggtgaagg aagacatggc tgctgttctg gctgctctga aagacgattt       420
     cagccgcaac ctcagcgttc gcacatcacc aggtgcactg gaccacatta cagtcaccac       480
     aaaggatggc aaatttcctc tcaaccagct gggccagata tccatgaagt ctcctcagct       540
     acttgtggtc aacatgactg gcttcccaga ggccatggta gccgtcaccc gtgccttgcg       600
     agagagcagc atgggactca acccagaggt ggagggcacc atcatcaggg tgcctgttcc       660
     caaggtaact cgtgaacaca gggagaatct ggtgaaactg gcgaagcagt tcagtaataa       720
     atctaaagac tcgttgagga gagtccgatc aaatgccatc agtcaagtga agaagagcaa       780
     agatgccgtt tctgatgata ccattcactt gatagaaaag cagattcaac aaatgaccga       840
     cagttttaca gcagacatcg acaaacagct ggcaactaaa accaaggagt tacttggatg       900
     acaacaaggc cttcaaactt tcacaacacc tccggaaacc caactatgtc ccactatcag       960
     gtcgaactgg aacaaaacaa aacagctaat gaactcactg acggaggcac tgaaggtggt      1020
     gttttggagg gtgtttttcc tcatgcataa acaaatgttg gcgtggcacg tcagtggttt      1080
     atggtgctcc ttgtgttctc atctgcaaac aaacaaacgg aggacaaatg acgttttaat      1140
     gtgatttgag gcactcctcc taatcaaagc gatgccacaa acgtggtgtt tatgtcaaaa      1200
     acacagtacc gaatgtaaat gctgtggtga aagtcacaca gggtgaacaa cgagtgcgca      1260
     catgatgtca acatttgttt cacatttaca tttacagccc aaaaatagtc atttattttt      1320
     ggctgtgtga tctgatctgc taatgtaaac tgaataaaat gcattggtta ttgttctgtt      1380
     aaaaaaaaaa aaaaaaaaaa aaaaa                                            1405
//

If you have problems or comments...

PBIL Back to PBIL home page