(data stored in ACNUC9552 zone)

EMBL: BC074505

ID   BC074505; SV 1; linear; mRNA; STD; VRT; 1338 BP.
XX
AC   BC074505;
XX
DT   29-JUN-2004 (Rel. 80, Created)
DT   16-JUL-2006 (Rel. 88, Last updated, Version 5)
XX
DE   Xenopus tropicalis BCL2-like 1, mRNA (cDNA clone MGC:69340 IMAGE:5309043),
DE   complete cds.
XX
KW   MGC.
XX
OS   Xenopus tropicalis (tropical clawed frog)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Amphibia;
OC   Batrachia; Anura; Pipoidea; Pipidae; Xenopodinae; Xenopus; Silurana.
XX
RN   [1]
RP   1-1338
RX   DOI; 10.1002/dvdy.10174.
RX   PUBMED; 12454917.
RA   Klein S.L., Strausberg R.L., Wagner L., Pontius J., Clifton S.W.,
RA   Richardson P.;
RT   "Genetic and genomic tools for Xenopus research: The NIH Xenopus
RT   initiative";
RL   Dev. Dyn. 225(4):384-391(2002).
XX
RN   [2]
RP   1-1338
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [3]
RC   NIH-MGC Project
RP   1-1338
RA   Klein S., Gerhard D.S.;
RT   ;
RL   Submitted (23-JUN-2004) to the INSDC.
RL   National Institutes of Health, Xenopus Gene Collection (XGC), National
RL   Institute of Child Health and Human Development, 6100 Executive Boulevard,
RL   Room 4B01, Rockville, MD 20892-7510, USA
XX
DR   MD5; aaa96e6bdc4f10ff9b4ab72278d12fb5.
DR   Ensembl-Gn; ENSXETG00000025175; xenopus_tropicalis.
DR   Ensembl-Tr; ENSXETT00000053903; xenopus_tropicalis.
XX
CC   Contact: XGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Robert M. Grainger
CC   cDNA Library Preparation: Life Technologies, Inc.
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: DOE Joint Genome Institute, Walnut Creek,
CC   California
CC   Web site: www.jgi.doe.gov
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAK Plate: 130 Row: g Column: 11
CC   This clone was selected for full length sequencing because it
CC   passed the following selection criteria: matched mRNA gi: 53749665.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1338
FT                   /organism="Xenopus tropicalis"
FT                   /lab_host="DH10B"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NICHD_XGC_Emb5"
FT                   /clone="MGC:69340 IMAGE:5309043"
FT                   /tissue_type="Embryo, Silurana tropicalis, gastrula (stages
FT                   10-13)"
FT                   /note="Vector: pCMV-SPORT6.1"
FT                   /db_xref="taxon:8364"
FT   gene            1..1338
FT                   /gene="bcl2l1"
FT                   /note="synonym: MGC69340"
FT   CDS_pept        289..894
FT                   /codon_start=1
FT                   /gene="bcl2l1"
FT                   /product="BCL2-like 1"
FT                   /db_xref="GOA:Q6GLI5"
FT                   /db_xref="InterPro:IPR002475"
FT                   /db_xref="InterPro:IPR003093"
FT                   /db_xref="InterPro:IPR013279"
FT                   /db_xref="InterPro:IPR020717"
FT                   /db_xref="InterPro:IPR020726"
FT                   /db_xref="InterPro:IPR026298"
FT                   /db_xref="InterPro:IPR036834"
FT                   /db_xref="UniProtKB/TrEMBL:Q6GLI5"
FT                   /protein_id="AAH74505.1"
FT                   /translation="MEGSSRDLVEKFVCKKLSQKGACGEFSSNSQPKGVSNGSSEGPGA
FT                   TQGIVGEEVLQALLDASEEFELRYQRAFSDLTAQLHLTQDTAQQSFQQVVGELFRDGTN
FT                   WGRIVAFFSFGRALCVESANKEMTELLPRIVQWMVQYLEHTLQPWMLENGGWEAFVGLY
FT                   GKGAAAQSREGPERFGRWLMAIVTVTAATLLVSYLRRR"
XX
SQ   Sequence 1338 BP; 292 A; 335 C; 449 G; 262 T; 0 other;
     tgtgtgcatt ggggttcgat gtataaaaaa catagttgag gcgcttgtaa cccggtgacg        60
     cagataccgc agtccgtgat gcatgacggg atgtcgtcgc ttccatggca acgagtgtag       120
     cctgcggaag ggaagccttg attgggccga aagagtgtca gtcagacagc aggggaaacg       180
     gcccttaggg tgagaggaaa gcgcggcgcc tggctggcac gctcttccct gggtggcagc       240
     gggacccatg tgacagtcgg gctcacccaa tgcctctcgg gcctgaccat ggagggcagc       300
     agtagagatc tggtggagaa gtttgtttgc aagaaactgt cccagaaagg agcctgcggg       360
     gagttctcca gcaactccca gcccaagggc gtgtctaatg gaagttcgga gggccccggg       420
     gccacacagg gcattgtggg ggaggaagtc cttcaggcgc tgctggacgc gtcggaggag       480
     tttgagttga gataccagcg tgccttcagc gacctgaccg cccagctgca cctcacccag       540
     gacactgccc agcaaagctt ccagcaggtg gtgggggagt tgttcaggga cggcaccaac       600
     tggggcagaa tcgtggcctt cttctccttt gggcgggccc tgtgcgtgga gagtgccaac       660
     aaggagatga ctgagctgct ccccaggatc gtgcaatgga tggtgcagta cctggagcat       720
     acgctgcagc cctggatgct ggagaacgga ggctgggaag cttttgtcgg tctgtacgga       780
     aagggagctg ccgcccagag cagggaaggg ccggagcggt ttggccggtg gctaatggcc       840
     atagtgactg tgactgctgc aaccttattg gtctcctacc tgaggcgtcg atagaccccc       900
     agaagttctg cggtgatgtg ctattggctg gcactggccc cacccatgga cacgataggc       960
     tggtggctcc caggttcaac atgtgttgag gttccctttg ctcagttaca gggagatgga      1020
     gccccggtgt attcacccca ataatctcat gggcccctcc cgtggagggg ggaaccccac      1080
     aacttgggaa cctcctggga agggggggaa ccccacaact tgggaacctc ctggggaggg      1140
     gggaaccccc acaacttggg aacctcctgg ggagggggga accccacaac ttgggaacct      1200
     cctggggagg gggggaaccc cacaacttgg gaacctcctg gggagggggg gaacctctgt      1260
     gttaggttgt ctgttattgc cttgcgctca gcagtggtta ttaaatgtta tgtttaaaaa      1320
     aaaaaaaaaa aaaaaaaa                                                    1338
//

If you have problems or comments...

PBIL Back to PBIL home page