(data stored in ACNUC8465 zone)

EMBL: BC074665

ID   BC074665; SV 1; linear; mRNA; STD; VRT; 3005 BP.
XX
AC   BC074665;
XX
DT   29-JUN-2004 (Rel. 80, Created)
DT   16-JUL-2006 (Rel. 88, Last updated, Version 6)
XX
DE   Xenopus tropicalis mitogen-activated protein kinase kinase 6, mRNA (cDNA
DE   clone MGC:69354 IMAGE:5309267), complete cds.
XX
KW   MGC.
XX
OS   Xenopus tropicalis (tropical clawed frog)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Amphibia;
OC   Batrachia; Anura; Pipoidea; Pipidae; Xenopodinae; Xenopus; Silurana.
XX
RN   [1]
RP   1-3005
RX   DOI; 10.1002/dvdy.10174.
RX   PUBMED; 12454917.
RA   Klein S.L., Strausberg R.L., Wagner L., Pontius J., Clifton S.W.,
RA   Richardson P.;
RT   "Genetic and genomic tools for Xenopus research: The NIH Xenopus
RT   initiative";
RL   Dev. Dyn. 225(4):384-391(2002).
XX
RN   [2]
RP   1-3005
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [3]
RC   NIH-MGC Project
RP   1-3005
RA   Klein S., Gerhard D.S.;
RT   ;
RL   Submitted (23-JUN-2004) to the INSDC.
RL   National Institutes of Health, Xenopus Gene Collection (XGC), National
RL   Institute of Child Health and Human Development, 6100 Executive Boulevard,
RL   Room 4B01, Rockville, MD 20892-7510, USA
XX
DR   MD5; 564354830eb914c03dab148ed3902d3f.
DR   Ensembl-Gn; ENSXETG00000022954; xenopus_tropicalis.
DR   Ensembl-Tr; ENSXETT00000049651; xenopus_tropicalis.
XX
CC   Contact: XGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Robert M. Grainger
CC   cDNA Library Preparation: Life Technologies, Inc.
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: DOE Joint Genome Institute, Walnut Creek,
CC   California
CC   Web site: www.jgi.doe.gov
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAK Plate: 130 Row: h Column: 20
CC   This clone was selected for full length sequencing because it
CC   passed the following selection criteria: matched mRNA gi: 54020814.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3005
FT                   /organism="Xenopus tropicalis"
FT                   /lab_host="DH10B"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NICHD_XGC_Emb5"
FT                   /clone="MGC:69354 IMAGE:5309267"
FT                   /tissue_type="Embryo, Silurana tropicalis, gastrula (stages
FT                   10-13)"
FT                   /note="Vector: pCMV-SPORT6.1"
FT                   /db_xref="taxon:8364"
FT   gene            1..3005
FT                   /gene="map2k6"
FT                   /note="synonym: MGC69354"
FT   CDS_pept        320..1327
FT                   /codon_start=1
FT                   /gene="map2k6"
FT                   /product="mitogen-activated protein kinase kinase 6"
FT                   /db_xref="GOA:Q6GL46"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:Q6GL46"
FT                   /protein_id="AAH74665.1"
FT                   /translation="MAQPRGKKKNPGLKIPKEAFDQPQVSSPTPPRDLDSKACILIGEK
FT                   NFEVKADDLEPIEELGRGAYGVVEKMRHVPSEQIMAVKRIRATVNSQEQKRLLMDLDIS
FT                   MRTVDCHFTVTFYGALFREGDVWICMELMDTSLDKFYKNVIDKGLTIPEDILGKIAVSI
FT                   VRALEHLHSKLSVIHRDVKPSNVLINKEGQVKMCDFGISGYLVDSVAKTMDAGCKPYMA
FT                   PERINPELNQKGYSVKSDIWSLGITLIELAILRFPYDSWGTPFQQLKQVVEEPSPQLPA
FT                   DKFSAEFVDFTSKCLKKNSKERPTYPELMQHHFFVLHESKNTDVASFVKRILGD"
XX
SQ   Sequence 3005 BP; 825 A; 580 C; 677 G; 923 T; 0 other;
     ccctggccca tcatgtaggt gcagagcccg ggctctcggc tgcaactgca aaggggatat        60
     cagagagaga gggaaaagga aagcgacatt gagaagggga gggctgtttg gccagtttgc       120
     atttgctact tgcacttgtg caattccaca gatccagccg agcgaggagt cctgcagcag       180
     cccgatcctg cataaactag actgggagcc tgcagtttgc atctttgttg tacaactaga       240
     gagagagaga ggggagaggc aaagtctttt gtgcacccct cccccagccc agcacagggg       300
     agagagagag agagagagaa tggctcagcc gagaggcaag aagaaaaatc ctgggctgaa       360
     aattccaaag gaggcatttg accagccaca agtcagctct ccgacgccac cacgggactt       420
     ggactccaaa gcctgcatcc tcataggaga aaagaacttt gaagtcaagg ccgatgactt       480
     ggaaccaata gaagagctag gccggggagc ctatggtgtc gtggaaaaga tgcgccatgt       540
     tcccagtgag cagataatgg cagtgaagcg catcagagca actgtgaaca gccaggaaca       600
     gaaaaggctg ctgatggacc tggatatctc tatgcgcaca gtggactgcc attttactgt       660
     cacgttttat ggggccttat ttagagaggg ggatgtctgg atctgcatgg agttgatgga       720
     tacgtcactg gataaatttt acaagaatgt gattgacaaa ggcctgacca tccccgagga       780
     catactagga aaaatagcag tttcgattgt tagagcatta gaacatctgc atagtaaact       840
     ctcagtgatc cacagagatg tgaaaccctc caacgtactg ataaacaaag aaggccaggt       900
     gaagatgtgt gactttggaa tcagcggtta tcttgttgac tctgtagcca aaaccatgga       960
     tgctggctgc aaaccctaca tggctcctga aagaataaac ccagagctga accagaaagg      1020
     gtatagtgta aaatcggaca tttggagcct tggaataaca ttgattgaac tggccattct      1080
     gcggtttcca tatgactcct gggggacccc tttccaacag ctaaaacaag tggtcgaaga      1140
     gccctcccca cagctgcctg cagacaagtt ttctgctgag tttgttgact ttacctcaaa      1200
     gtgcttgaag aaaaattcca aagagcgtcc aacttatcca gagcttatgc aacaccattt      1260
     ctttgtgctg catgaatcca agaacactga tgtggcatct ttcgttaaac gcatcttggg      1320
     agattaagta tatgcagtat agccggtctc accttctcat ggacttttcc tctgacagga      1380
     cacacggaat ggcttaaatt ggctgtccta cttaatcaag caccagtaga aatgcctcat      1440
     gggactggga aaactggact caatagttct ttctaatggc cactcttcgc tacggaacgg      1500
     tttttccagc atggaaagat gtctaacccc tatgctgcca taggtaccct tatggctgta      1560
     caggtgttac tatagatgcc tcttgccaaa gggtgtaact ttgactgctg ccgtatgggg      1620
     tttatattta ggtttcctat tctttttgac ctttttgtat tggttctagg tgctatttta      1680
     gttcctcttt aacatggttt cttctttatt tttttccttc ctactttcat tttggagata      1740
     tttatgttct gtattctgat taggtttggt ttttatgaaa ggacgtgtgt gtgatataag      1800
     aggagaacag tggcaaatat ttatagggtt ttgctggtga gagggtgaaa tctttgtgtc      1860
     cgctattatt taagttgttt ttttttttgt tttgtttctg gaactgctaa agaattctgg      1920
     aatttttctt tggaatgaga ataggtatat gtgcggagat tatgacttgg tcacacatga      1980
     ataaatagtg ttggcttgtt gttgattact gaggggcagg cagttgtccc ctctcagaag      2040
     gaatccagac atagtctact gtgttatctg aagccttaat aacctttaaa agtggagatt      2100
     ttttcctgta gaataatctt gaggttctgt aataatgtta cgcctgaaag agaagagaat      2160
     taaaatgatt tacctctcct gtggtgagca atcttattga cagtttgtgg ttacatgcag      2220
     caggcccttc tagttctcct acctcccttc ttatttcata tatcttgcta ctttggataa      2280
     ttatagggcg acatagggcc aaccaatcat ttttttttgt ccacgcagac tttcactgta      2340
     accagtaaca tttgaggttt ctgttgaagt cgaactcttc ccagaggttg tcttcctctt      2400
     tgtcctttgc cccttatctt tctcattttt cctgttggag gattttgctt gtgctttact      2460
     ctttttaaag tattttacag catttagaaa ttatatatat attttttttc tgtgttttat      2520
     acctcttttc ccctgagggg tctgcaactg attagaactt tttccccttt ctagatctac      2580
     atgagggtga atccaccata aaaacacctg agtaaattgt gatttctaat aaattacaca      2640
     cagttttttt tttgttttgt tttttttaat ttataaccat tttttgttgc tgcatgaggc      2700
     acctgcaggt ctttgcaaga ggtaaaccag tcatggtatc catgacaaat agaaatgttt      2760
     gtattgtgca gaggtgagtt tattcagggc atcatttttt tctgtttagt tcaaatttgg      2820
     ccattgtatg ttgtatgact tcgacagcgg atactgtggg gttataatac tatgtatgtc      2880
     cttaatgagc aaaacacaga gaaaactagg agtatatttc caatccagtg acatgtcttg      2940
     cataccaatt atatttttta atgtcaaaaa aaaaaaaaaa aaaaaaaaaa aaaaaaaaaa      3000
     aaaaa                                                                  3005
//

If you have problems or comments...

PBIL Back to PBIL home page