(data stored in ACNUC23059 zone)

EMBL: BC075917

ID   BC075917; SV 1; linear; mRNA; STD; VRT; 902 BP.
XX
AC   BC075917;
XX
DT   08-JUL-2004 (Rel. 80, Created)
DT   21-OCT-2008 (Rel. 97, Last updated, Version 5)
XX
DE   Danio rerio zgc:92182, mRNA (cDNA clone MGC:92182 IMAGE:7051277), complete
DE   cds.
XX
KW   MGC.
XX
OS   Danio rerio (zebrafish)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
OC   Actinopterygii; Neopterygii; Teleostei; Ostariophysi; Cypriniformes;
OC   Cyprinidae; Danio.
XX
RN   [1]
RP   1-902
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-902
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (06-JUL-2004) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; 7dc4392065b87587a930eda88981a0a0.
DR   Ensembl-Gn; ENSDARG00000103145; danio_rerio.
DR   Ensembl-Tr; ENSDART00000165373; danio_rerio.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Len Zon, Harvard
CC   cDNA Library Preparation: Open Biosystems
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: Sequencing Group at the Stanford Human Genome
CC   Center, Stanford University School of Medicine, Stanford, CA  94305
CC   Web site:       http://www-shgc.stanford.edu
CC   Contact:  (Dickson, Mark) mcd@paxil.stanford.edu
CC   Dickson, M., Schmutz, J., Grimwood, J., Rodriquez, A., and Myers,
CC   R. M.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAK Plate: 179 Row: i Column: 11
CC   This clone was selected for full length sequencing because it
CC   passed the following selection criteria: matched mRNA gi: 49900386.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..902
FT                   /organism="Danio rerio"
FT                   /lab_host="DH10B"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NIH_ZGC_7"
FT                   /clone="MGC:92182 IMAGE:7051277"
FT                   /tissue_type="Whole, adult zebrafish"
FT                   /note="Vector: pExpress1"
FT                   /db_xref="taxon:7955"
FT   gene            1..902
FT                   /gene="zgc:92182"
FT   CDS_pept        314..649
FT                   /codon_start=1
FT                   /gene="zgc:92182"
FT                   /product="zgc:92182"
FT                   /db_xref="GOA:Q6DHQ0"
FT                   /db_xref="InterPro:IPR017266"
FT                   /db_xref="UniProtKB/TrEMBL:Q6DHQ0"
FT                   /db_xref="ZFIN:ZDB-GENE-040718-35"
FT                   /protein_id="AAH75917.1"
FT                   /translation="MSYKPIAPAPTGSNHTPPGSCGSSPSLASSSNFRPAFSDFGPPSM
FT                   GFVQPVKVSQGSTYSELLSVIEEMSREIRPTYAGSKSAMERLKRGIIHARALVRECLAE
FT                   TERSART"
XX
SQ   Sequence 902 BP; 240 A; 245 C; 187 G; 230 T; 0 other;
     ggagaagaac cgacacctcc gcgcacagaa actattcccg tgcgttaata ttcatattta        60
     cctccccgaa caactacaaa ccggcgaaca gaaaccacat ttaaccgttc agcgagtcgt       120
     gaagtgttcc cggttgttgt tgtcggtttc atttgtcggc ttgttggata tttagcgcgt       180
     gtcgctgtcg agcgagtttg cggaagaggt caacgccgtt cctgcttcgg acgccaaagc       240
     ccaacgagat tacattcggg ggataagcag aaagttttca tcacgcgagg ttacagtcga       300
     cggcggtgta aatatgagtt acaagccgat cgcccccgca cccaccggct ccaaccacac       360
     tcctccagga tcttgtggct cttctccatc actggcctcc tcttcaaact ttagaccagc       420
     atttagtgac ttcggtcctc catcgatggg ctttgtacag ccggtcaaag tgtcccaggg       480
     atctacctat agtgagctgc tctccgtcat tgaggagatg agccgtgaaa ttcggcctac       540
     ctacgccggc agcaaaagtg ccatggagag actgaagaga ggtatcatcc acgcacgtgc       600
     tctcgtcagg gagtgtctag cggagacaga gcgaagtgct cgcacataac atcaacacac       660
     acacacatcc tccctctggt actcatctcc ccattgttct gtctctctct gcccagctat       720
     ttacaacacc atctctttct gtctttctta ttgacctttg ttccattatg catagccatc       780
     tccccgacgt acacctcatg tagtgttact gcgattagca tagacatttt ttaagcccaa       840
     tttttgcaat tctgtattta aataaaaaac aaaatcaaaa aaaaaaaaaa aaaaaaaaaa       900
     aa                                                                      902
//

If you have problems or comments...

PBIL Back to PBIL home page