(data stored in ACNUC18858 zone)

EMBL: BC075950

ID   BC075950; SV 1; linear; mRNA; STD; VRT; 1800 BP.
XX
AC   BC075950;
XX
DT   08-JUL-2004 (Rel. 80, Created)
DT   21-OCT-2008 (Rel. 97, Last updated, Version 6)
XX
DE   Danio rerio glucosaminyl (N-acetyl) transferase 4, core 2, mRNA (cDNA clone
DE   MGC:92232 IMAGE:7052429), complete cds.
XX
KW   MGC.
XX
OS   Danio rerio (zebrafish)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
OC   Actinopterygii; Neopterygii; Teleostei; Ostariophysi; Cypriniformes;
OC   Cyprinidae; Danio.
XX
RN   [1]
RP   1-1800
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-1800
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (06-JUL-2004) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; c50c20345465629ef329334d309b3fe6.
DR   Ensembl-Gn; ENSDARG00000035198; danio_rerio.
DR   Ensembl-Tr; ENSDART00000050988; danio_rerio.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Len Zon, Harvard
CC   cDNA Library Preparation: Open Biosystems
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: Sequencing Group at the Stanford Human Genome
CC   Center, Stanford University School of Medicine, Stanford, CA  94305
CC   Web site:       http://www-shgc.stanford.edu
CC   Contact:  (Dickson, Mark) mcd@paxil.stanford.edu
CC   Dickson, M., Schmutz, J., Grimwood, J., Rodriquez, A., and Myers,
CC   R. M.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAK Plate: 179 Row: k Column: 19
CC   This clone was selected for full length sequencing because it
CC   passed the following selection criteria: matched mRNA gi: 49902762.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1800
FT                   /organism="Danio rerio"
FT                   /lab_host="DH10B"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NIH_ZGC_7"
FT                   /clone="MGC:92232 IMAGE:7052429"
FT                   /tissue_type="Whole, adult zebrafish"
FT                   /note="Vector: pExpress1"
FT                   /db_xref="taxon:7955"
FT   gene            1..1800
FT                   /gene="gcnt4"
FT                   /note="synonyms: wu:fc31c11, fc31c11, c2gnt3"
FT   CDS_pept        121..1407
FT                   /codon_start=1
FT                   /gene="gcnt4"
FT                   /product="glucosaminyl (N-acetyl) transferase 4, core 2"
FT                   /db_xref="GOA:Q71SG7"
FT                   /db_xref="InterPro:IPR003406"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q71SG7"
FT                   /db_xref="ZFIN:ZDB-GENE-030131-3231"
FT                   /protein_id="AAH75950.1"
FT                   /translation="MRRCAVLHRLRCKFYVFVVSLFVVVKLVYLKISMDNSIYIEPYGV
FT                   TRRSLKPQPLDGINCTAIYDLEPVEIGKSLEMRRKKIVEVDDGRIASFTADCKSYIEQR
FT                   RYNEVLVTDEECNFPIAYSLVVHKNSAMVERILRAIYAPQNIYCIHYDQKSTKDFIAAM
FT                   KNLESCFPNVFIASKIESVQYAHITRLKADLNCLSDLLSSEVKWKYVINLCGQDFPLKS
FT                   NYELVTELRKLNGANMLETSRPSKVKKQRFQFRYQLKDVSYEYQKMPVKTSIAKDPPPH
FT                   NIEMFVGSAYFVLSRDFVTYVMNNQLAKDFLQWSVDTYSPDEHFWASMARVPGVPGELA
FT                   RSEPDVSDLKSRTRLVKWNYLEERLYPKCTGTHRRSVCIYGAAELRWLLEDGHWFANKF
FT                   DPKVDPVIIKCLEEKLEEKQLQQCLRRVS"
XX
SQ   Sequence 1800 BP; 551 A; 337 C; 395 G; 517 T; 0 other;
     agagaagcgc ggtgaagcag caactccacg cagtctcaac agcagttgtt tatatttttt        60
     gcaatgttga gaaacatttg atggcagtga cacaaaacaa aagaccggca gtgtgcaaga       120
     atgagaagat gtgctgtctt acaccggtta agatgcaagt tctatgtgtt tgtcgtgtca       180
     ctgtttgtcg tggtgaagct ggtgtactta aagatttcaa tggacaacag tatctacatc       240
     gagccctatg gagttacacg tagatctctc aaacctcagc cactggatgg cattaactgc       300
     acagccattt atgacctgga accagtggaa attggcaagt cgctggagat gaggcgcaaa       360
     aaaattgtgg aagttgatga tgggagaatt gcttcgttca ctgcggattg caaaagctac       420
     atcgaacaaa ggcgctacaa tgaagtcttg gtcactgatg aggaatgtaa ctttccaatc       480
     gcatactctt tggtggtgca caagaacagc gcaatggtgg aaaggatact tcgagccatc       540
     tatgcacctc agaatattta ctgcattcat tatgaccaaa aatccacaaa ggattttatt       600
     gcagcgatga agaacttgga gagttgtttt ccaaatgtct tcatcgcctc taaaatcgaa       660
     tccgtccagt atgcgcacat taccagactt aaagcagatc tcaattgcct ttcagactta       720
     ctgagttcag aggtcaaatg gaaatatgtc atcaatctgt gtggtcaaga ctttccactg       780
     aagtctaatt atgagctggt gactgagctc cggaaactaa acggcgcaaa catgctcgaa       840
     acaagcaggc ccagcaaagt aaaaaagcaa cgctttcagt ttagatacca gttgaaagat       900
     gtatcgtatg aataccagaa gatgcctgtt aaaacctcca ttgctaaaga cccaccgcca       960
     cataacattg agatgtttgt tggaagtgct tactttgtct tgtcacggga ttttgtgaca      1020
     tatgttatga ataatcaact ggcgaaggat tttcttcagt ggtcagtcga cacatattct      1080
     cccgatgagc acttttgggc atcaatggca agagttcccg gagttcctgg ggagttagca      1140
     agatctgaac ctgatgtgtc agacctgaag agcaggacac gcttggttaa atggaactat      1200
     ctcgaagagc gattgtatcc aaagtgcact ggtacacaca gacgtagtgt ctgcatctat      1260
     ggtgcagcgg agctccggtg gcttctggag gacggccatt ggtttgcaaa caagtttgat      1320
     cccaaagttg accctgtcat tattaaatgt cttgaggaga aacttgagga gaagcaactt      1380
     caacaatgct tgaggagagt gtcttaaaag aggctttctt tgattgaaat atgcatcttt      1440
     gctgctttaa tctctgttca aaacaccagc aaggtgaaag gtttagctgt atcttaaagt      1500
     tattccattc atgttcatat tgccgtctgc tacatattct aggtctttat gctaatgagt      1560
     ttggaagtgc ctaacagctt cagctttaat acttcacaca aatgatgaat gtgtgtggga      1620
     aatatttata cattttaatt aagtatttat tttaatttat ttaaccaaca atgtcttgca      1680
     tgaagaatct attgtttact gaatcagtgg tgacagtttt acaacttgat tgtatttttc      1740
     ttttgtcatt ggttttcaaa ataaacaatg cagctaaaaa aaaaaaaaaa aaaaaaaaaa      1800
//

If you have problems or comments...

PBIL Back to PBIL home page