(data stored in ACNUC13479 zone)

EMBL: BC076224

ID   BC076224; SV 1; linear; mRNA; STD; VRT; 1144 BP.
XX
AC   BC076224;
XX
DT   08-JUL-2004 (Rel. 80, Created)
DT   21-OCT-2008 (Rel. 97, Last updated, Version 5)
XX
DE   Danio rerio zgc:92746, mRNA (cDNA clone MGC:92746 IMAGE:7082656), complete
DE   cds.
XX
KW   MGC.
XX
OS   Danio rerio (zebrafish)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
OC   Actinopterygii; Neopterygii; Teleostei; Ostariophysi; Cypriniformes;
OC   Cyprinidae; Danio.
XX
RN   [1]
RP   1-1144
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-1144
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (06-JUL-2004) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; 73794ca0809db954926de8e492658504.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Takuya Sakaguchi and Didier Stainier
CC   cDNA Library Preparation: Dr. Sumio Sugano
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: Sequencing Group at the Stanford Human Genome
CC   Center, Stanford University School of Medicine, Stanford, CA  94305
CC   Web site:       http://www-shgc.stanford.edu
CC   Contact:  (Dickson, Mark) mcd@paxil.stanford.edu
CC   Dickson, M., Schmutz, J., Grimwood, J., Rodriquez, A., and Myers,
CC   R. M.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAK Plate: 180 Row: i Column: 5.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1144
FT                   /organism="Danio rerio"
FT                   /lab_host="DH10B"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NIH_ZGC_8"
FT                   /clone="MGC:92746 IMAGE:7082656"
FT                   /tissue_type="Liver, AB, adult zebrafish"
FT                   /note="Vector: pME18S-FL3"
FT                   /db_xref="taxon:7955"
FT   gene            1..1144
FT                   /gene="zgc:92746"
FT                   /note="synonyms: wu:fk57h10, zgc:111820, fk57h10"
FT   CDS_pept        30..830
FT                   /codon_start=1
FT                   /gene="zgc:92746"
FT                   /product="zgc:92746"
FT                   /db_xref="GOA:Q6DGW3"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR019009"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q6DGW3"
FT                   /db_xref="ZFIN:ZDB-GENE-040718-311"
FT                   /protein_id="AAH76224.1"
FT                   /translation="MEERVDLDLEDFSSEPFLETFLKEIQNEDAVFLVGIFVALALVIL
FT                   TIVFFGNFWGSSKVRNAVLLLGLCDSGKTLLFTRLLLGKFVRTQTSITESSATYKSKSE
FT                   RGNSWTLIDVPGHESLRTQIVEKYKDVARAIVFVVDSSIFQKDVRDVAEFLYSILTDSI
FT                   LAKNAPTLVVACNKQDITMAKSAKLIQQQLEKELNTLRLTRSAALSSQDGAVGGSVYLG
FT                   KKGKDFEFSQLANRVEFIECKARGSKTEDGDADIDALEKCLAKL"
XX
SQ   Sequence 1144 BP; 330 A; 226 C; 278 G; 310 T; 0 other;
     ctgctgtgtt tccatgtgta gaggaaagca tggaggaaag ggttgatctg gatttagagg        60
     atttctcttc agagccgttt ttggaaacgt tcttgaaaga gatccagaat gaagacgctg       120
     ttttcctcgt cgggatattt gtagcattgg cgcttgtgat tctcactatc gttttctttg       180
     ggaatttttg gggctccagt aaagtgagga atgcagtgct gttgctggga ctgtgtgact       240
     ccgggaagac tcttctgttc actcgattat tactaggaaa gtttgtacga actcagacgt       300
     ccatcacaga gagcagtgcc acatacaaga gcaaaagtga gagaggcaac agttggaccc       360
     ttatcgatgt tcctggtcat gaaagtttaa gaactcagat tgttgagaag tacaaggatg       420
     tggcacgagc catcgtgttc gtggtggaca gcagcatctt ccagaaggat gtcagagatg       480
     tggctgagtt tctctactcc atcctcacag acagcatcct ggccaaaaat gccccaacac       540
     tggtggtggc ctgcaacaaa caagatatca cgatggccaa atctgccaaa ttaattcagc       600
     agcagctaga gaaggagttg aacacactga gactgacccg ctcggcagcg ctctcctctc       660
     aggacggggc ggtcgggggc tcggtgtact tagggaagaa aggcaaagat ttcgagttct       720
     ctcagttggc caatcgggtg gagttcatcg agtgcaaagc cagaggaagc aaaaccgagg       780
     atggagatgc tgacattgat gctttggaga agtgcctagc caaactctga agatcacaca       840
     gctggagtta ttcagtaatt taattcaact tttcttgatg ttgtctctgg atttcactca       900
     tcattgctgt atcagtgtac atcatgtccg gatactgtag atgcagcaca caaatcaaac       960
     tgaatcactg tataatgcac ccctcaggca cctgtttgct ttttccttct cactccaggg      1020
     ttttattaaa gtttaagctg gagtcaggtc aacgtttacc ttttatttta tttcgctgta      1080
     aattatatta aagatggatt atcttgaaaa aaaaaaaaaa aaaaaaaaaa aaaaaaaaaa      1140
     aaaa                                                                   1144
//

If you have problems or comments...

PBIL Back to PBIL home page