(data stored in ACNUC30309 zone)

EMBL: BC078340

ID   BC078340; SV 1; linear; mRNA; STD; VRT; 2090 BP.
XX
AC   BC078340;
XX
DT   21-JUL-2004 (Rel. 80, Created)
DT   21-OCT-2008 (Rel. 97, Last updated, Version 9)
XX
DE   Danio rerio RasGEF domain family, member 1Bb, mRNA (cDNA clone MGC:91814
DE   IMAGE:7036547), complete cds.
XX
KW   MGC.
XX
OS   Danio rerio (zebrafish)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
OC   Actinopterygii; Neopterygii; Teleostei; Ostariophysi; Cypriniformes;
OC   Cyprinidae; Danio.
XX
RN   [1]
RP   1-2090
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-2090
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (19-JUL-2004) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; 437fc896c054866175b7b661ef25d8ab.
DR   Ensembl-Gn; ENSDARG00000044251; danio_rerio.
DR   Ensembl-Gn; ENSDARG00000117029; danio_rerio.
DR   Ensembl-Tr; ENSDART00000064968; danio_rerio.
DR   Ensembl-Tr; ENSDART00000182968; danio_rerio.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Len Zon, Harvard
CC   cDNA Library Preparation: Open Biosystems
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: National Institutes of Health Intramural
CC   Sequencing Center (NISC),
CC   Gaithersburg, Maryland;
CC   Web site: http://www.nisc.nih.gov/
CC   Contact: nisc_mgc@nhgri.nih.gov
CC   Akhter,N., Ayele,K., Beckstrom-Sternberg,S.M., Benjamin,B.,
CC   Blakesley,R.W., Bouffard,G.G., Breen,K., Brinkley,C., Brooks,S.,
CC   Dietrich,N.L., Granite,S., Guan,X., Gupta,J., Haghighi,P.,
CC   Hansen,N., Ho,S.-L., Karlins,E., Kwong,P., Laric,P., Legaspi,R.,
CC   Maduro,Q.L., Masiello,C., Maskeri,B., Mastrian,S.D.,McCloskey,J.C.,
CC   McDowell,J., Pearson,R., Stantripop,S., Thomas,P.J., Touchman,J.W.,
CC   Tsurgeon,C., Vogt,J.L., Walker,M.A., Wetherby,K.D., Wiggins,L.,
CC   Young,A., Zhang,L.-H. and Green,E.D.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAK Plate: 178 Row: c Column: 10
CC   This clone was selected for full length sequencing because it
CC   passed the following selection criteria: matched mRNA gi: 50417009.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2090
FT                   /organism="Danio rerio"
FT                   /lab_host="DH10B"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NIH_ZGC_7"
FT                   /clone="MGC:91814 IMAGE:7036547"
FT                   /tissue_type="Whole, adult zebrafish"
FT                   /note="Vector: pExpress1"
FT                   /db_xref="taxon:7955"
FT   gene            1..2090
FT                   /gene="rasgef1bb"
FT                   /note="synonyms: im:7136415, fc34e01, rasgef, wu:fc34e01,
FT                   zgc:91814"
FT   CDS_pept        236..1663
FT                   /codon_start=1
FT                   /gene="rasgef1bb"
FT                   /product="RasGEF domain family, member 1Bb"
FT                   /db_xref="GOA:Q6DBW1"
FT                   /db_xref="InterPro:IPR000651"
FT                   /db_xref="InterPro:IPR001895"
FT                   /db_xref="InterPro:IPR008937"
FT                   /db_xref="InterPro:IPR019804"
FT                   /db_xref="InterPro:IPR023578"
FT                   /db_xref="InterPro:IPR036964"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6DBW1"
FT                   /db_xref="ZFIN:ZDB-GENE-040801-220"
FT                   /protein_id="AAH78340.1"
FT                   /translation="MPQTTPYSSKFNPSAYSSSHSHRQPVEENYGGLHYRDNKLVSGSL
FT                   EALIQLLVPTVDYYPDRSYIFTFLLSSRLFLNPFELMSRVCYLGVDHHRVGDPQMDKKR
FT                   IRDIAPKIVQLLTEWTETFPYDFRDERMMRSLKEMTHRLAFGDELSRRAMQRLIQRLLR
FT                   KLTTLGQYEESLATTSAAAAIDRPVALKSKQQLVRRDDCVLNLCDDPFIFAQQLTHIEM
FT                   ERLSYIGPEEFVRAFAQKRPSDNHKSFFSKRKASNLEAYVEWFNRLSYLTATEICMPVK
FT                   KKHRARVLEFFIDVAQECFNIGNFNSLMAIITGMNMNPVSRLKKTWGKVNTDKFDILVH
FT                   QMDPSSNFYSYRTALRGATQRSSTAHTSQEMIVIPFFSLFIKDIYFLNEGCANRLSNGH
FT                   INFEKFWELAKQVSEFLSWRQVICPFERDRKTLQYLISAPVFSEDELQLASYESEGPEN
FT                   NLERDTRRSLRSSLSRM"
XX
SQ   Sequence 2090 BP; 597 A; 479 C; 462 G; 552 T; 0 other;
     cacaatggag accgtcggtc atcacaaagt atccgcttgc gctacaacaa caatgaattg        60
     attatttgtg tcgcacgcag aaagaaaaga taagaagact atcagcgacc tttcattgta       120
     agaaagcaac ttgatctgtg ctgcgcacgc gatttggacg ctttttgctg gacttccttg       180
     gatatccata tctcagcttt cttttaaact cactgttttg atcgcgtggt ccaacatgcc       240
     acaaacaact ccatattcaa gcaaattcaa tccaagtgct tacagcagca gccacagtca       300
     ccggcagcct gtggaggaga actatggggg tttgcactat cgtgataata agcttgtttc       360
     tggctctctg gaagccctca tacagctctt ggtccctaca gtagactatt accctgacag       420
     atcctacatt ttcactttcc tgctaagctc ccgcctcttt ctgaacccat ttgagctcat       480
     gtctcgggtt tgttacctcg gtgtggacca tcacagggtt ggagacccac aaatggataa       540
     gaaaagaata cgggatatcg caccgaaaat cgtgcagctg ctaacagaat ggacagagac       600
     ctttccgtac gacttcaggg acgagcggat gatgcgcagc ctcaaagaaa tgacccatcg       660
     ccttgccttc ggtgatgagc tttcacggag ggccatgcag cgactcattc agcggctctt       720
     acgcaagctg accaccctcg gacagtacga agagtctctg gccacaacca gcgccgctgc       780
     cgccattgac cgaccggtcg ccctgaagtc aaagcagcag ttagtgcgca gagatgactg       840
     cgttttaaac ctgtgcgacg accctttcat tttcgcccag cagctgacac atattgagat       900
     ggagcgcctc agctacattg gccctgaaga attcgttcga gcgtttgccc agaaaagacc       960
     ctcagataac cataagagtt tcttcagtaa aagaaaagca agcaacctgg aggcttatgt      1020
     cgaatggttc aacagactga gctacctgac agccacagaa atttgcatgc cggtgaaaaa      1080
     gaaacacagg gcaagagtgc tggagttctt catagatgtg gcacaggaat gcttcaacat      1140
     cggcaacttc aactcattaa tggctatcat tactggaatg aacatgaatc cagtatccag      1200
     actgaagaaa acctggggca aagtcaacac agacaagttt gacatcctgg tgcaccaaat      1260
     ggacccatct agcaacttct acagctaccg cacagccctg cgtggagcaa ctcagaggtc      1320
     tagtacagca cacacaagcc aagaaatgat tgttatccca ttcttcagct tgttcatcaa      1380
     agatatctac ttccttaatg aaggttgtgc taatagatta tctaacggcc acatcaattt      1440
     tgagaaattt tgggagctgg ccaagcaagt gagcgagttt ctgtcgtgga ggcaggtgat      1500
     ctgtcctttc gagagagaca gaaaaacatt gcagtatctc atcagcgcac cagtgttcag      1560
     tgaagatgag cttcagctag catcatatga gagtgaaggc cctgaaaaca acttggagag      1620
     agacacacgc cgttccctca ggtcatctct cagtcgaatg tgaaaggtga actttgggat      1680
     tgtgtcctga aactaggact gatggcactg aagactttga aggactttaa ttatcattac      1740
     actagttttt tttccctctg tgctgaaatt gaggctggat tctcatcgtg acagtaacaa      1800
     tatgctaaca gaatcatatt catctcattt acctcacgta ccttcatgaa atgtgttata      1860
     atcatgctat atagatcttc tgggtgaatt gagagcatgt cgctggctga cctgttctat      1920
     tattgcatca tgtttcgttt ttgcttttgg taagtggtga tagtttgtgt actgaacata      1980
     tttgttacaa tattaagaga tatttttatg tgtgttatag tttttgtgtg acctgtgtac      2040
     atgtttcccg gtaaagtatc tctgaaataa aaaaaaaaaa aaaaaaaaaa                 2090
//

If you have problems or comments...

PBIL Back to PBIL home page