(data stored in ACNUC32233 zone)

EMBL: BC079628

ID   BC079628; SV 1; linear; mRNA; STD; MUS; 3212 BP.
XX
AC   BC079628;
XX
DT   18-AUG-2004 (Rel. 80, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 3)
XX
DE   Mus musculus spectrin beta 3, mRNA (cDNA clone IMAGE:5695868), partial cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-3212
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-3212
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (02-AUG-2004) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; 5754de1268ad1785da9046cf1d090f13.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Dr. Jim Lin, University of Iowa
CC   cDNA Library Preparation: M. Bento Soares, University of Iowa
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: National Institutes of Health Intramural
CC   Sequencing Center (NISC),
CC   Gaithersburg, Maryland;
CC   Web site: http://www.nisc.nih.gov/
CC   Contact: nisc_mgc@nhgri.nih.gov
CC   Akhter,N., Ayele,K., Beckstrom-Sternberg,S.M., Benjamin,B.,
CC   Blakesley,R.W., Bouffard,G.G., Breen,K., Brinkley,C., Brooks,S.,
CC   Dietrich,N.L., Granite,S., Guan,X., Gupta,J., Haghighi,P.,
CC   Hansen,N., Ho,S.-L., Karlins,E., Kwong,P., Laric,P., Legaspi,R.,
CC   Maduro,Q.L., Masiello,C., Maskeri,B., Mastrian,S.D.,McCloskey,J.C.,
CC   McDowell,J., Pearson,R., Stantripop,S., Thomas,P.J., Touchman,J.W.,
CC   Tsurgeon,C., Vogt,J.L., Walker,M.A., Wetherby,K.D., Wiggins,L.,
CC   Young,A., Zhang,L.-H. and Green,E.D.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAK Plate: 176 Row: b Column: 9
CC   This clone was selected for full length sequencing because it
CC   passed the following selection criteria: Hexamer frequency ORF
CC   analysis.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3212
FT                   /organism="Mus musculus"
FT                   /lab_host="DH10B"
FT                   /strain="C57BL/6"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NIH_BMAP_EH0p"
FT                   /clone="IMAGE:5695868"
FT                   /tissue_type="Brain, day 18.5pc (3 -4 kb fragment)"
FT                   /note="Vector: pYX-ASC"
FT                   /db_xref="taxon:10090"
FT   gene            <1..3212
FT                   /gene="Spnb3"
FT                   /note="synonym: mKIAA0302"
FT   CDS_pept        <1..2563
FT                   /codon_start=2
FT                   /gene="Spnb3"
FT                   /product="Spnb3 protein"
FT                   /db_xref="GOA:Q68FM2"
FT                   /db_xref="InterPro:IPR001605"
FT                   /db_xref="InterPro:IPR001849"
FT                   /db_xref="InterPro:IPR002017"
FT                   /db_xref="InterPro:IPR011993"
FT                   /db_xref="InterPro:IPR018159"
FT                   /db_xref="InterPro:IPR041681"
FT                   /db_xref="MGI:MGI:1313261"
FT                   /db_xref="UniProtKB/TrEMBL:Q68FM2"
FT                   /protein_id="AAH79628.1"
FT                   /translation="EIQGHEPRIADLKERQRTLGTAAAGPELAELQEMWKRLSHELELR
FT                   GKRLEEALRAQQFYRDAAEAEAWMGEQELHMMGQEKAKDELSAQAEVKKHQVLEQALAD
FT                   YAQTIKQLAASSQDMIDHEHPESTRLTIRQAQVDKLYASLKELAGERRERLQEHLRLCQ
FT                   LRRELDDLEQWIQEREVVAASHELGQDYEHVTMLRDKFREFSKDTSTIGQERVDSANAL
FT                   ANGLIAGGHAARATVAEWKDSLNEAWADLLELLDTRGQVLAAAYELQRFLHGARQALAR
FT                   VQHKQQQLPDGTGRDLNAAEALQRRHCAYEHDIQALSTQVQQVQDDGQRLQKAYAGDKA
FT                   EEIGRHMQAVAEAWAQLQGSSAARRQLLLDTTDKFRFFKAVRELMLWMDGINLQMDAQE
FT                   RPRDVSSADLVIKNQQGIKAEIEARADRFSSCIDMGQELLARSHYAAEEISEKLSQLQS
FT                   RRQETADKWQEKMDWLQLVLEVLVFGRDAGMAEAWLCSQEPLVRSAELGCTVDEVESLI
FT                   KRHEAFQKSAVAWEERFSALEKLTALEERENERKRKREEEERRKQPPTSEPMASQPEGS
FT                   LVDGQRVPDTAWDGTQSKLPPSTQAPSVNGVCTDTDSSQPLLEQQRLEQSNVPEGPGSG
FT                   TGDESSGPRGERQTLPRGPAPSPMPQSRSSEAAHGATLPTRGPELSAQEQMEGMLCRKQ
FT                   EMEAFNKKAANRSWQNVYCVLRRGSLGFYKDARAASAGVPYHGEVPVSLARAQGSVAFD
FT                   YRKRKHVFKLGLQDGKEYLFQAKDEAEMSSWLRVVNAAIATASSAPGESEEPVVPSASR
FT                   GLTRAMTMPPVSQPEGSIVLRSKDGREREREKRFSFFKKNK"
XX
SQ   Sequence 3212 BP; 807 A; 862 C; 964 G; 579 T; 0 other;
     ggagatccag ggccatgagc cccggattgc agacctcaaa gagaggcagc gcactctggg        60
     aacagcagca gcaggtccag agctggctga gctccaagaa atgtggaaac gcctgagcca       120
     tgagctggag cttcggggca agcggctgga ggaagctctt cgagcccagc aattctatcg       180
     tgatgctgca gaggccgagg cttggatggg tgagcaggag ttacacatga tgggccagga       240
     aaaggccaag gatgagctga gcgcccaggc agaagtgaag aagcatcagg tattggaaca       300
     agcccttgct gactatgccc agaccatcaa acaactagca gccagcagtc aagatatgat       360
     tgaccatgaa catccagaga gcacaagact aacaatacgc caagcccagg tggacaagct       420
     gtacgccagc ctgaaggagc tggcaggaga gcggcgcgag cgcctgcagg agcacctccg       480
     gctgtgccag ctccgcagag agctggatga cctggaacag tggatacagg agcgtgaagt       540
     tgtggcagcc tcccatgaac tgggccaaga ctatgagcac gtgactatgc ttcgggacaa       600
     attccgagag ttctccaagg acaccagcac cattggccag gagcgcgtag acagtgccaa       660
     tgcactggcc aatgggctca ttgctggggg ccatgctgca cgggccactg tggccgagtg       720
     gaaggacagt ctcaatgagg cctgggctga cctgctggag ctgctggaca caagaggtca       780
     ggtgctggct gctgcgtatg agctgcagcg cttcctgcat ggagcccgcc aagccctggc       840
     acgggtacag cacaagcagc agcagcttcc agacgggact ggccgtgacc tcaatgctgc       900
     tgaggccctg cagcgccggc actgtgccta tgagcacgac atccaagccc tcagcactca       960
     ggtccagcaa gttcaagatg atggccaaag gctacagaag gcctatgctg gagacaaggc      1020
     tgaggaaatt ggccgtcaca tgcaggcagt ggctgaggcc tgggcccagc tccagggaag      1080
     ttctgctgcc cgccgacagc tgttactgga taccacggac aaattccgat tctttaaggc      1140
     tgtccgagag ttgatgctgt ggatggatgg gattaacctg cagatggatg cccaggagcg      1200
     gccccgggat gtgtcctctg cagatttagt catcaaaaac caacaaggaa tcaaagcaga      1260
     gatagaggcc agagcagaca ggttctcctc ctgcattgac atggggcagg agctgctggc      1320
     ccggagccac tatgctgctg aggagatctc agagaagctg tctcagctac agtcccggcg      1380
     ccaggagaca gctgacaagt ggcaggagaa gatggactgg ctacagcttg ttttggaggt      1440
     gcttgtgttt gggagagatg cagggatggc ggaggcctgg ctgtgcagtc aggagccatt      1500
     ggtgcgaagt gcagaactgg gttgcactgt ggacgaagta gagagcctca tcaagcgaca      1560
     tgaagccttt cagaagtcgg ccgtggcctg ggaagagcgt ttcagtgcgc tggagaagct      1620
     cactgcgctg gaagagcggg aaaatgagcg gaaaaggaag agggaggagg aggaacggag      1680
     gaaacagcct cctacttcag agcccatggc tagtcagcca gaagggagtc tggtagatgg      1740
     ccagagagtt cctgacactg cctgggatgg gactcagtca aaattgccac catccacaca      1800
     agcacccagt gttaatgggg tctgcacgga caccgactcc tcacagcccc tgttggaaca      1860
     gcagagactt gaacagagca atgtccccga aggacctgga tctggcacag gagacgagtc      1920
     cagtgggccc cggggagaga ggcagaccct gccccggggc cctgctcctt ctccaatgcc      1980
     ccagagcaga tcatctgaag cagctcatgg tgccaccctg cccacacgag gacctgagct      2040
     ctctgctcag gaacagatgg aagggatgct gtgccgcaaa caagagatgg aagccttcaa      2100
     caagaaagct gccaacaggt catggcagaa tgtgtactgt gtacttcggc gtgggagcct      2160
     cggcttttac aaggatgcca gggcagctag tgcaggagtg ccctaccatg gagaagtgcc      2220
     tgtcagcctg gccagggccc agggaagtgt ggcctttgat tatcggaaac gcaaacatgt      2280
     tttcaagctg ggcttacagg atggcaaaga atacctattc caggccaagg acgaggcaga      2340
     gatgagctca tggctgagag tggtgaatgc agccattgcc actgcatcct ctgcccctgg      2400
     agagtcagaa gagccagtgg tgcccagtgc cagccggggt ctgacccggg ccatgaccat      2460
     gcccccagtg tcacagcctg agggttccat cgtgcttcga agcaaggatg gcagagaaag      2520
     agagcgagaa aaacgattca gcttctttaa gaagaacaag tagtcggggc aagactccca      2580
     ggccagctcc ctccctctgt tcagaaaact gccagggact gtcgacagag accaccctct      2640
     tggcaggaca actgcctgct gctagggtct gctgctaagg tcaacccatc accaggaact      2700
     gtcactgggg acaaaagagt gttcccacaa ccttctcttc tgctatttaa ttcaactggt      2760
     ggtgggaccc aggctacccc taataccacc cattcctacc ttgtcacctc ttcccaagcc      2820
     ttatacctcc acccatcccc ccaccatggt gcagatagtg ccaccctcaa cgtgggctat      2880
     gtgggaacca ttgtccctgc ctcagggtca ttgtgccacc acagctaggg tgtgccatcc      2940
     accattcagt tctttgcctc tgggatcagc caggaccctc agagctgaag caggcaggac      3000
     ctgagggcag gagcgccaga tgatgaagtc ggaggcgctg aagccttccc tgcctatcct      3060
     gcctcaccct ctgactcaag gggctgcttg tttccagcca ctctaggtgg ctcccaagtg      3120
     tgagttgttc aggagtagcc acatccttga gcctatccaa ggaggtgatt aaacagctcg      3180
     acttctctca aaaaaaaaaa aaaaaaaaaa aa                                    3212
//

If you have problems or comments...

PBIL Back to PBIL home page