(data stored in ACNUC32233 zone)

EMBL: BC079860

ID   BC079860; SV 1; linear; mRNA; STD; MUS; 8254 BP.
XX
AC   BC079860;
XX
DT   18-AUG-2004 (Rel. 80, Created)
DT   21-OCT-2008 (Rel. 97, Last updated, Version 9)
XX
DE   Mus musculus spectrin beta 3, mRNA (cDNA clone MGC:99874 IMAGE:6834745),
DE   complete cds.
XX
KW   MGC.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-8254
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-8254
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (09-AUG-2004) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; 6973e964a0409fccc12faa802889ee96.
DR   Ensembl-Gn; ENSMUSG00000067889; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0024670; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0024636; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0024609; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0024636; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0024404; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0025083; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0023876; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0024375; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0024503; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0024470; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0024589; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0024500; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0025131; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0023622; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0023938; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000008991; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0050481; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0050462; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0050418; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0050414; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0050157; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0050905; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0050285; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0050093; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0050186; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0050153; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0050314; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0050156; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0051021; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0049885; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0049454; mus_musculus_wsbeij.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Dr. Jim Lin, University of Iowa
CC   cDNA Library Preparation: M. Bento Soares, University of Iowa
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: University of Iowa, Dr. M. Bento Soares and Dr.
CC   Thomas L. Casavant.
CC   Web site: http://genome.uiowa.edu
CC   Contact: bento-soares@uiowa.edu; tom-casavant@uiowa.edu
CC   Bonaldo,M.F., Akabogu,I.,  Bair,T., Bair,J., Crouch,K., Davis,A.,
CC   Fishler,K., Keppel,C., Kucaba,T., Lebeck,M., Melo,A., Schaefer,K.,
CC   Scheetz,T., Smith,C., Snir,E., Tack,D., Trout,K., Walters,J.,
CC   Casavant,T., Soares,M.B.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series:  Plate:  Row:  Column: 0
CC   This clone was selected for full length sequencing because it
CC   passed the following selection criteria: Hexamer frequency ORF
CC   analysis.
CC   Differences found between this sequence and the mouse C57BL/6J
CC   genome (build 36) are described in misc_difference features below.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..8254
FT                   /organism="Mus musculus"
FT                   /lab_host="DH10B"
FT                   /strain="C57BL/6"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NIH_BMAP_FO0"
FT                   /clone="MGC:99874 IMAGE:6834745"
FT                   /tissue_type="Brain, enriched mouse brain 12.5dp"
FT                   /note="Vector: pYX-ASC"
FT                   /db_xref="taxon:10090"
FT   gene            1..8254
FT                   /gene="Spnb3"
FT                   /note="synonym: mKIAA0302"
FT   CDS_pept        445..7611
FT                   /codon_start=1
FT                   /gene="Spnb3"
FT                   /product="spectrin beta 3"
FT                   /db_xref="GOA:Q68FG2"
FT                   /db_xref="InterPro:IPR001589"
FT                   /db_xref="InterPro:IPR001605"
FT                   /db_xref="InterPro:IPR001715"
FT                   /db_xref="InterPro:IPR001849"
FT                   /db_xref="InterPro:IPR002017"
FT                   /db_xref="InterPro:IPR011993"
FT                   /db_xref="InterPro:IPR016343"
FT                   /db_xref="InterPro:IPR018159"
FT                   /db_xref="InterPro:IPR036872"
FT                   /db_xref="InterPro:IPR041681"
FT                   /db_xref="MGI:MGI:1313261"
FT                   /db_xref="UniProtKB/TrEMBL:Q68FG2"
FT                   /protein_id="AAH79860.1"
FT                   /translation="MSSTLSPTDFDSLEIQGQYSDINNRWDLPDSDWDNDSSSARLFER
FT                   SRIKALADEREAVQKKTFTKWVNSHLARVTCRVGDLYSDLRDGRNLLRLLEVLSGETLP
FT                   KPTKGRMRIHCLENVDKALQFLKEQKVHLENMGSHDIVDGNHRLTLGLVWTIILRFQIQ
FT                   DISVETEDNKEKKSAKDALLLWCQMKTAGYPNVNVHNFTTSWRDGLAFNAIVHKHRPDL
FT                   LDFESLKKCNAHYNLQNAFNLAEKELGLTKLLDPEDVNVDQPDEKSIITYVATYYHYFS
FT                   KMKALAVEGKRIGKVLDHAMEAEHLVEKYESLASELLQWIEQTIVTLNDRQLANSLSGV
FT                   QNQLQSFNSYRTVEKPPKFTEKGNLEVLLFTIQSKLRANNQKVYTPREGRLISDINKAW
FT                   ERLEKAEHERELALRTELIRQEKLEQLAARFDRKAAMRETWLSENQRLVSQDNFGLELA
FT                   AVEAAVRKHEAIETDIVAYSGRVQAVDAVAAELAAEHYHDIKRIAARQNNVARLWDFLR
FT                   QMVAARRERLLLNLELQKVFQDLLYLMDWMAEMKGRLQSQDLGKHLAGVEDLLQLHELV
FT                   EADIAVQAERVRAVSASALRFCDPGKEYRPCDPQLVSERVATLEQSYEALCELAATRRA
FT                   RLEESRRLWRFLWEVGEAEAWVREQQHLLASADTGRDLTGVLRLLNKHAALRGEMSGRL
FT                   GPLKLTLEQGQQLVAEGHPGANQASTRAAELQAQWERLEALAEERAQQLAQAASLYQFQ
FT                   ADANDMEAWLVDALRLVSSPEVGHDEFSTQALARQHRALEEEIRAHRPTLDALREQAAA
FT                   LPPALSHTPEVQGRVPTLEQHYEELQARAGERARALEAALAFYTMLSEAGACGLWVEEK
FT                   EQWLNGLALPERLEDLEVVQQRFETLEPEMNALAARVTAVNDIAEQLLKASPPGKDRII
FT                   GTQEQLNQRWQQFRSLADGKKAALTSALSIQNYHLECTETQAWMREKTKVIESTQGLGN
FT                   DLAGVLALQRKLAGTERDLEAISARVGELTQEANALAAGHPAQAPAINTRLGEVQAGWE
FT                   DLRATMRRREESLGEARRLQDFLRSLDDFQAWLGRTQTAVASEEGPATLPEAEALLAQH
FT                   AALRGEVERAQSEYSRLRTLGEEVTRDQADPQCLFLRQRLEALGTGWEELGRMWESRQG
FT                   RLAQAHGFQGFLRDARQAEGVLSSQEYVLSHTEMPGTLQAADAAIKKLEDFMSTMDANG
FT                   ERIRGLLEAGRQLVSKGNIHAEKIQEKADSIEKRHRKNQEAVQQLLGRLRDNREQQHFL
FT                   QDCQELRLWIDEKMLTAQDVSYDEARNLHTKWQKHQAFMAELAANKDWLDKVDKEGREL
FT                   TLEKPELKVVVSEKLEDLHRRWDELETTTQAKARSLFDANRAELFAQSCSALESWLESL
FT                   QAQLHSDDYGKDLTSVNILLKKQQMLEREMAVREKEVEAIQAQAQALAQEDQSAGEVER
FT                   TSRAVEEKFRALCQPMKERCRRLHASREQHQFHRDVEDEILWVTERLPMASSLEHGKDL
FT                   PSVQLLMKKNQTLQKEIQGHEPRIADLKERQRTLGTAAAGPELAELQEMWKRLSHELEL
FT                   RGKRLEEALRAQQFYRDAAEAEAWMGEQELHMMGQEKAKDELSAQAEVKKHQVLEQALA
FT                   DYAQTIKQLAASSQDMIDHEHPESTRLTIRQAQVDKLYASLKELAGERRERLQEHLRLC
FT                   QLRRELDDLEQWIQEREVVAASHELGQDYEHVTMLRDKFREFSKDTSTIGQERVDSANA
FT                   LANGLIAGGHAARATVAEWKDSLNEAWADLLELLDTRGQVLAAAYELQRFLHGARQALA
FT                   RVQHKQQQLPDGTGRDLNAAEALQRRHCAYEHDIQALSTQVQQVQDDGQRLQKAYAGDK
FT                   AEEIGRHMQAVAEAWAQLQGSSAARRQLLLDTTDKFRFFKAVRELMLWMDGINLQMDAQ
FT                   ERPRDVSSADLVIKNQQGIKAEIEARADRFSSCIDMGQELLARSHYAAEEISEKLSQLQ
FT                   SRRQETADKWQEKMDWLQLVLEVLVFGRDAGMAEAWLCSQEPLVRSAELGCTVDEVESL
FT                   IKRHEAFQKSAVAWEERFSALEKLTALEERENERKRKREEEERRKQPPTSEPMASQPEG
FT                   SLVDGQRVPDTAWDGTQSKLPPSTQAPSVNGVCTDTDSSQPLLEQQRLEQSNVPEGPGS
FT                   GTGDESSGPRGERQTLPRGPAPSPMPQSRSSEAAHGATLPTRGPELSAQEQMEGMLCRK
FT                   QEMEAFNKKAANRSWQNVYCVLRRGSLGFYKDARAASAGVPYHGEVPVSLARAQGSVAF
FT                   DYRKRKHVFKLGLQDGKEYLFQAKDEAEMSSWLRVVNAAIATASSAPGESEEPVVPSAS
FT                   RGLTRAMTMPPVSQPEGSIVLRSKDGREREREKRFSFFKKNK"
FT   misc_difference 8236..8254
FT                   /gene="Spnb3"
FT                   /note="polyA tail: 19 bases do not align to the mouse
FT                   genome."
XX
SQ   Sequence 8254 BP; 2043 A; 2227 C; 2544 G; 1440 T; 0 other;
     tttgggcata tttccttcct ctcctaggca gatagcagct caccttggtt aatgccatta        60
     aaccgtagac cactcagctg ctaataaacc aggaagaaac ccggccgtgc taggactaga       120
     aatgtccatc cctgccccca acccccttaa gacagtgact aggccggaat tctcctggtt       180
     gataaatgag aggagctgag gagccgctgt gatgacggtt ccgagaatct gatttgtgag       240
     aaggcgaatc tccaggagca ccatggagat gcttttggaa agcgggccag cctacctgcc       300
     agaaggagga cgagagaaag ggggcaaggc agagagaaac gcttaagcga gatggcctgg       360
     aggtgcccca aaagggacct ttgaaaagga aacggaggcc gcatctcggg gaaacctcgg       420
     aggaacagga agccacccac caccatgagc agcactctgt cacccactga ctttgacagc       480
     ttggagatcc agggccagta cagtgacatc aacaaccgct gggacctgcc tgactcagac       540
     tgggacaatg acagcagttc ggcccgcctc tttgagaggt ccaggatcaa ggccctggca       600
     gatgagcgag aagccgtgca gaagaaaacc ttcaccaagt gggtgaactc ccacctggcc       660
     cgggtgacat gccgggtggg agacctgtac agcgacctgc gggacgggcg caacctcctg       720
     aggctcctgg aggtgctctc gggagagacc ctgccaaaac ctaccaaggg ccgaatgcgg       780
     attcactgcc tggagaatgt agataaagcg ctgcagttcc tgaaggagca gaaggtgcac       840
     ttggaaaaca tgggctccca tgacattgtg gacggaaacc accgtctgac ccttgggcta       900
     gtgtggacca tcatcctccg atttcagatc caagacatca gtgtggagac agaagacaac       960
     aaggagaaga agtcagccaa ggatgccctg ctgctgtggt gccagatgaa gactgcagga      1020
     taccccaatg tcaatgtgca caactttacc accagttgga gagatgggct ggcctttaat      1080
     gccattgtgc acaaacaccg gccagacctg ttggattttg agtccctgaa gaagtgtaat      1140
     gcacactaca atctgcagaa tgctttcaat ctggctgaaa aggaacttgg cctgacgaag      1200
     ctcctggatc ctgaagatgt gaatgtagac cagcccgacg agaagtctat catcacctac      1260
     gtggccactt actaccacta cttctccaag atgaaggccc tggctgtgga aggcaaaaga      1320
     attggcaagg tcctagacca tgccatggag gcagaacacc tggtagagaa atacgagtcc      1380
     ctggcctctg aactgctgca gtggattgag caaacgatcg tgaccctcaa tgaccgacag      1440
     ctggccaact ccctgagtgg agtccagaac cagctgcagt ctttcaactc ctatcgcact      1500
     gtggagaagc cacccaagtt cacggagaaa gggaacttgg aggtgttgct cttcaccatc      1560
     cagagcaagc tacgggccaa caaccagaag gtctacacac cccgggaagg ccggctcatc      1620
     tcggacatca acaaggcctg ggagcggctg gagaaagccg aacatgagcg agagctagcg      1680
     ctgcgcacag agctgatccg ccaggagaag ctggagcaac tggctgctcg cttcgaccgc      1740
     aaggctgcca tgcgggagac ctggctcagt gagaaccagc gacttgtgtc ccaggacaac      1800
     tttgggctgg aactggcagc agtggaggct gcagtgagaa agcatgaagc cattgagaca      1860
     gacattgtcg cctacagtgg ccgggtgcag gcggtggatg ctgtagctgc agaactggct      1920
     gctgagcact accatgacat taagcgcatt gcggcacgtc agaacaacgt ggcccggctc      1980
     tgggacttct tacggcaaat ggtggctgcc cgccgtgaga gacttcttct caacctggag      2040
     ctgcagaaag tgtttcagga cctgctctac ctcatggact ggatggcaga gatgaagggc      2100
     cgactgcagt ctcaggactt gggcaagcac ctggctggag tggaggacct cctgcagcta      2160
     cacgaactgg tggaggcgga catcgcggtt caggctgaga gggttcgagc ggtcagcgcc      2220
     tctgccctgc gtttctgcga cccagggaaa gagtataggc catgtgaccc acagctggtg      2280
     tcagagaggg tggccactct ggagcagagc tatgaggccc tgtgtgaatt ggcagcgact      2340
     agaagggccc gactggaaga gtcacgtcgt ctctggaggt tcctctggga agtgggtgag      2400
     gctgaggcct gggtccggga gcagcagcac ctcctggcct cagctgatac aggccgggac      2460
     ctgactggtg tccttcgcct gctcaacaag cacgcagccc tacggggtga gatgagtggc      2520
     cgtctggggc ccctgaagct caccctggag caaggtcagc agttagtcgc tgagggccac      2580
     cctggagcca accaagcctc aacccgtgca gccgagctcc aggcccagtg ggagcgacta      2640
     gaagccctgg ccgaggagcg agcccagcag ctggcacagg ctgccagcct ctaccagttc      2700
     caggcagatg caaatgacat ggaggcctgg ttggtggatg cactgcgcct ggtatctagc      2760
     cccgaggtag ggcacgacga gttctccaca caggccctgg ccaggcagca cagggccctt      2820
     gaagaggaga tccgagccca ccggcctaca ctggatgccc tgagggagca ggctgcagcc      2880
     ctgccacctg cactgagcca cacaccggag gtacagggca gggtgcccac tctggagcag      2940
     cactatgagg agctgcaggc ccgagccggt gagcgtgcac gagccctgga ggcagccctg      3000
     gcgttctata ccatgctcag cgaggctggg gcctgtggcc tctgggtaga ggagaaggag      3060
     caatggctca acgggctggc cctacctgag cgcctggagg acctggaggt ggtccagcag      3120
     aggtttgaga ccctggagcc tgaaatgaac gccctggctg cacgggttac tgctgtcaat      3180
     gacatcgctg agcagctgct gaaggccagt ccaccaggca aggaccgcat cattggcacc      3240
     caggagcagc tcaaccaaag gtggcagcag tttcggtccc tggcagatgg caaaaaggcg      3300
     gctctgacat cagccctgag catccagaat taccacctag agtgcacaga gacccaggcc      3360
     tggatgagag agaagactaa ggtcattgag tccacccagg gcctgggcaa tgatctagct      3420
     ggtgtgctgg ccctgcagcg gaagttggcg ggtactgaga gagatctgga agctatctct      3480
     gcccgggtgg gtgagctgac ccaagaggca aatgccttgg ctgctgggca cccagctcaa      3540
     gctcctgcca tcaacacccg gcttggagag gtacaagcag gatgggaaga tcttcgggcg      3600
     accatgaggc ggagagaaga gtccctgggt gaggctcggc ggctgcagga tttcctgcgc      3660
     agcttggatg acttccaggc ctggctaggc cgcacacaga ccgctgtagc ctccgaagaa      3720
     gggccagcca cccttcccga ggcagaagcc ctcttagccc agcacgcagc tctgcgggga      3780
     gaagtggaga gagcccagag cgagtacagc cgcctcagga ccttgggcga ggaggtgacc      3840
     agagaccagg ctgatcccca gtgcctcttc ctcagacaga ggctggaagc ccttggaacc      3900
     ggctgggagg agctgggtcg catgtgggag agccggcaag gccgcctggc ccaggcccat      3960
     ggcttccagg ggtttttaag agatgctcgc caggctgagg gtgttctcag cagccaggaa      4020
     tatgtcttgt ctcacacgga gatgccaggg acactgcagg cggcagatgc agccattaaa      4080
     aagctggaag acttcatgag cactatggac gccaatggag agcgcatccg cggactcctg      4140
     gaggctggac gtcagctggt gtccaagggc aatatccatg ctgagaagat ccaagagaag      4200
     gcggactcca tcgagaagag gcacagaaag aatcaggagg cggtgcagca gcttttagga      4260
     cgccttcggg acaaccgaga gcagcagcac ttcttgcaag actgtcagga gctgagactc      4320
     tggatcgatg agaagatgct gacagctcag gatgtgtcct atgacgaagc tcgcaacctg      4380
     cacaccaagt ggcagaaaca ccaggcattc atggccgagc ttgcagccaa caaggactgg      4440
     ctggacaaag tggacaagga agggcgggag ctgactcttg aaaagccaga actcaaagtc      4500
     gtagtgtcag agaagctgga ggacctgcac cggcgctggg atgaactgga gaccactacc      4560
     caagccaagg cccgcagtct ttttgatgcc aaccgggcag agctatttgc tcaaagctgt      4620
     tctgccctgg agagctggct ggagagcctg caggcccagc tgcactcaga tgactatggc      4680
     aaagacctca ccagtgtcaa cattctgctg aagaagcaac agatgctgga acgagagatg      4740
     gctgtgagag agaaggaggt agaggcgata caggcccagg cccaggccct ggcccaggaa      4800
     gaccagagtg caggggaggt agaaaggacc tcaagggctg tggaggagaa gttcagggcc      4860
     ttgtgtcaac ccatgaaaga acgctgccgg cgcctgcacg cctcccggga gcagcaccag      4920
     ttccaccggg atgtggagga tgagatattg tgggtgactg agcggcttcc catggccagc      4980
     tctctggaac atggcaagga cttgcccagt gtccagcttc tcatgaagaa aaaccagacc      5040
     ctgcagaagg agatccaggg ccatgagccc cggattgcag acctcaaaga gaggcagcgc      5100
     actctgggaa cagcagcagc aggtccagag ctggctgagc tccaagaaat gtggaaacgc      5160
     ctgagccatg agctggagct tcggggcaag cggctggagg aagctcttcg agcccagcaa      5220
     ttctatcgtg atgctgcaga ggccgaggct tggatgggtg agcaggagtt acacatgatg      5280
     ggccaggaaa aggccaagga tgagctgagc gcccaggcag aagtgaagaa gcatcaggta      5340
     ttggaacaag cccttgctga ctatgcccag accatcaaac aactagcagc cagcagtcaa      5400
     gatatgattg accatgaaca tccagagagc acaagactaa caatacgcca agcccaggtg      5460
     gacaagctgt acgccagcct gaaggagctg gcaggagagc ggcgcgagcg cctgcaggag      5520
     cacctccggc tgtgccagct ccgcagagag ctggatgacc tggaacagtg gatacaggag      5580
     cgtgaagttg tggcagcctc ccatgaactg ggccaagact atgagcacgt gactatgctt      5640
     cgggacaaat tccgagagtt ctccaaggac accagcacca ttggccagga gcgcgtagac      5700
     agtgccaatg cactggccaa tgggctcatt gctgggggcc atgctgcacg ggccactgtg      5760
     gccgagtgga aggacagtct caatgaggcc tgggctgacc tgctggagct gctggacaca      5820
     agaggtcagg tgctggctgc tgcgtatgag ctgcagcgct tcctgcatgg agcccgccaa      5880
     gccctggcac gggtacagca caagcagcag cagcttccag acgggactgg ccgtgacctc      5940
     aatgctgctg aggccctgca gcgccggcac tgtgcctatg agcacgacat ccaagccctc      6000
     agcactcagg tccagcaagt tcaagatgat ggccaaaggc tacagaaggc ctatgctgga      6060
     gacaaggctg aggaaattgg ccgtcacatg caggcagtgg ctgaggcctg ggcccagctc      6120
     cagggaagtt ctgctgcccg ccgacagctg ttactggata ccacggacaa attccgattc      6180
     tttaaggctg tccgagagtt gatgctgtgg atggatggga ttaacctgca gatggatgcc      6240
     caggagcggc cccgggatgt gtcctctgca gatttagtca tcaaaaacca acaaggaatc      6300
     aaagcagaga tagaggccag agcagacagg ttctcctcct gcattgacat ggggcaggag      6360
     ctgctggccc ggagccacta tgctgctgag gagatctcag agaagctgtc tcagctacag      6420
     tcccggcgcc aggagacagc tgacaagtgg caggagaaga tggactggct acagcttgtt      6480
     ttggaggtgc ttgtgtttgg gagagatgca gggatggcgg aggcctggct gtgcagtcag      6540
     gagccattgg tgcgaagtgc agaactgggt tgcactgtgg acgaagtaga gagcctcatc      6600
     aagcgacacg aagcctttca gaagtcggcc gtggcctggg aagagcgttt cagtgcgctg      6660
     gagaagctca ctgcgctgga agagcgggaa aatgagcgga aaaggaagag ggaggaggag      6720
     gaacggagga aacagcctcc tacttcagag cccatggcta gtcagccaga agggagtctg      6780
     gtagatggcc agagagttcc tgacactgcc tgggatggga ctcagtcaaa attgccacca      6840
     tccacacaag cacccagtgt taatggggtc tgcacggaca ccgactcctc acagcccctg      6900
     ttggaacagc agagacttga acagagcaat gtccccgaag gacctggatc tggcacagga      6960
     gacgagtcca gtgggccccg gggagagagg cagaccctgc cccggggccc tgctccttct      7020
     ccaatgcccc agagcagatc atctgaagca gctcatggtg ccaccctgcc cacacgagga      7080
     cctgagctct ctgctcagga acagatggaa gggatgctgt gccgcaaaca agagatggaa      7140
     gccttcaaca agaaagctgc caacaggtca tggcagaatg tgtactgtgt acttcggcgt      7200
     gggagcctcg gcttttacaa ggatgccagg gcagctagtg caggagtgcc ctaccatgga      7260
     gaagtgcctg tcagcctggc cagggcccag ggaagtgtgg cctttgatta tcggaaacgc      7320
     aaacatgttt tcaagctggg cttacaggat ggcaaagaat acctattcca ggccaaggac      7380
     gaggcagaga tgagctcatg gctgagagtg gtgaatgcag ccattgccac tgcatcctct      7440
     gcccctggag agtcagaaga gccagtggtg cccagtgcca gccggggtct gacccgggcc      7500
     atgaccatgc ccccagtgtc acagcctgag ggttccatcg tgcttcgaag caaggatggc      7560
     agagaaagag agcgagaaaa acgattcagc ttctttaaga agaacaagta gtcggggcaa      7620
     gactcccagg ccagctccct ccctctgttc agaaaactgc cagggactgt cgacagagac      7680
     caccctcttg gcaggacaac tgcctgctgc tagggtctgc tgctaaggtc aacccatcac      7740
     caggaactgt cactggggac aaaagagtgt tcccacaacc ttctcttctg ctatttaatt      7800
     caactggtgg tgggacccag gctaccccta ataccaccca ttcctacctt gtcacctctt      7860
     cccaagcctt atacctccac ccatcccccc accatggtgc agatagtgcc accctcaacg      7920
     tgggctatgt gggaaccatt gtccctgcct cagggtcatt gtgccaccac agctagggtg      7980
     tgccatccac cattcagttc tttgcctctg ggatcagcca ggaccctcag agctgaagca      8040
     ggcaggacct gagggcagga gcgccagatg atgaagtcgg aggcgctgaa gccttccctg      8100
     cctatcctgc ctcaccctct gactcaaggg gctgcttgtt tccagccact ctaggtggct      8160
     cccaagtgtg agttgttcag gagtagccac atccttgagc ctatccaagg aggtgattaa      8220
     acagctcgac ttctcaaaaa aaaaaaaaaa aaaa                                  8254
//

If you have problems or comments...

PBIL Back to PBIL home page