(data stored in ACNUC9543 zone)

EMBL: BC081430

ID   BC081430; SV 1; linear; mRNA; STD; MUS; 518 BP.
XX
AC   BC081430;
XX
DT   11-SEP-2004 (Rel. 81, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 7)
XX
DE   Mus musculus ribosomal protein L27a, mRNA (cDNA clone MGC:101958
DE   IMAGE:6411497), complete cds.
XX
KW   MGC.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-518
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-518
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (01-SEP-2004) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; ba6d3488013e21dae08f9b17a61e60b1.
DR   Ensembl-Gn; ENSMUSG00000046364; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0032842; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0032826; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0032757; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0032830; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0032540; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0033336; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0031868; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0032513; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0032665; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0032618; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0032759; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0032650; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0033357; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0031575; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0031981; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000143107; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0085815; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0085891; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0085832; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0085856; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0085415; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0086357; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0085933; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0085358; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0085552; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0085403; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0085598; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0085445; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0086644; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0085338; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0084463; mus_musculus_wsbeij.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Dr. Jim Lin, University of Iowa
CC   cDNA Library Preparation: M. Bento Soares, University of Iowa
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: Sequencing Group at the Stanford Human Genome
CC   Center, Stanford University School of Medicine, Stanford, CA  94305
CC   Web site:       http://www-shgc.stanford.edu
CC   Contact:  (Dickson, Mark) mcd@paxil.stanford.edu
CC   Dickson, M., Schmutz, J., Grimwood, J., Rodriquez, A., and Myers,
CC   R. M.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAK Plate: 195 Row: e Column: 12
CC   This clone was selected for full length sequencing because it
CC   passed the following selection criteria: matched mRNA gi: 31560516.
CC   Differences found between this sequence and the mouse C57BL/6J
CC   genome (build 36) are described in misc_difference features below.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..518
FT                   /organism="Mus musculus"
FT                   /lab_host="DH10B"
FT                   /strain="C57BL/6"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NIH_BMAP_FP0"
FT                   /clone="MGC:101958 IMAGE:6411497"
FT                   /tissue_type="Brain, enriched mouse brain 15dpc"
FT                   /note="Vector: pYX-ASC"
FT                   /db_xref="taxon:10090"
FT   gene            1..518
FT                   /gene="Rpl27a"
FT                   /note="synonym: L27A"
FT   CDS_pept        10..456
FT                   /codon_start=1
FT                   /gene="Rpl27a"
FT                   /product="ribosomal protein L27a"
FT                   /db_xref="GOA:P14115"
FT                   /db_xref="InterPro:IPR001196"
FT                   /db_xref="InterPro:IPR021131"
FT                   /db_xref="InterPro:IPR030878"
FT                   /db_xref="InterPro:IPR036227"
FT                   /db_xref="MGI:MGI:1347076"
FT                   /db_xref="UniProtKB/Swiss-Prot:P14115"
FT                   /protein_id="AAH81430.1"
FT                   /translation="MPSRLRKTRKLRGHVSHGHGRIGKHRKHPGGRGNAGGMHHHRINF
FT                   DKYHPGYFGKVGMRHYHLKRNQSFCPTVNLDKLWTLVSEQTRVNAAKNKTGVAPIIDVV
FT                   RSGYYKVLGKGKLPKQPVIVKAKFFSRRAEEKIKGVGGACVLVA"
FT   misc_difference 498..518
FT                   /gene="Rpl27a"
FT                   /note="polyA tail: 21 bases do not align to the mouse
FT                   genome."
XX
SQ   Sequence 518 BP; 160 A; 126 C; 136 G; 96 T; 0 other;
     gccaccgcca tgccatccag actgaggaag acccggaaac tccggggcca cgtgagccac        60
     ggccacggcc gcatcggtaa gcaccgcaag cacccaggcg gccgcgggaa tgctggaggc       120
     atgcaccacc acaggatcaa ctttgacaaa tatcacccag gttactttgg gaaagttggt       180
     atgcggcatt accacttgaa gaggaaccag agcttctgcc caacagtcaa cctggataaa       240
     ctgtggacat tggtcagcga gcagacacgg gtcaatgcgg caaaaaacaa gactggagtt       300
     gctcccatca ttgatgttgt tcgatcaggc tactacaaag ttctgggcaa gggaaagctc       360
     cctaagcaac ctgtcatcgt gaaggccaaa ttcttcagca gaagagctga ggagaagatt       420
     aagggtgttg gaggtgcctg tgttctggtg gcttaaaagc cacaccggag gttaattaaa       480
     tgctaacatt ttccatgaaa aaaaaaaaaa aaaaaaaa                               518
//

If you have problems or comments...

PBIL Back to PBIL home page