(data stored in ACNUC15465 zone)

EMBL: BC081536

ID   BC081536; SV 1; linear; mRNA; STD; HUM; 414 BP.
XX
AC   BC081536;
XX
DT   03-SEP-2004 (Rel. 81, Created)
DT   19-MAR-2009 (Rel. 100, Last updated, Version 16)
XX
DE   Homo sapiens G antigen 7, transcript variant 2, mRNA (cDNA clone MGC:105124
DE   IMAGE:30524801), complete cds.
XX
KW   MGC.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-414
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-414
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (01-SEP-2004) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; b1fdb8ef8b436986850d8092faba6f02.
DR   Ensembl-Gn; ENSG00000236362; homo_sapiens.
DR   Ensembl-Tr; ENST00000440137; homo_sapiens.
DR   Ensembl-Tr; ENST00000639028; homo_sapiens.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: James Martin, University of Iowa
CC   cDNA Library Preparation: M. Bento Soares, University of Iowa
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: Sequencing Group at the Stanford Human Genome
CC   Center, Stanford University School of Medicine, Stanford, CA  94305
CC   Web site:       http://www-shgc.stanford.edu
CC   Contact:  (Dickson, Mark) mcd@paxil.stanford.edu
CC   Dickson, M., Schmutz, J., Grimwood, J., Rodriquez, A., and Myers,
CC   R. M.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAK Plate: 201 Row: a Column: 3
CC   This clone was selected for full length sequencing because it
CC   passed the following selection criteria: matched mRNA gi: 4503876.
CC   Differences found between this sequence and the human reference
CC   genome (build 36) are described in misc_difference features below.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..414
FT                   /organism="Homo sapiens"
FT                   /lab_host="DH10B"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NIH_MGC_217"
FT                   /clone="MGC:105124 IMAGE:30524801"
FT                   /tissue_type="Chondrosarcoma, myxoid chondrosarcoma Grade
FT                   II, mixture of 3 cell lines, enriched for 0.5-1.0 Kb mRNA"
FT                   /note="Vector: pYX-ASC"
FT                   /db_xref="taxon:9606"
FT   gene            1..414
FT                   /gene="GAGE7"
FT                   /gene_synonym="GAGE-7"
FT   CDS_pept        72..299
FT                   /codon_start=1
FT                   /gene="GAGE7"
FT                   /gene_synonym="GAGE-7"
FT                   /product="G antigen 7"
FT                   /db_xref="H-InvDB:HIT000265926_08.4"
FT                   /db_xref="HGNC:HGNC:31906"
FT                   /db_xref="InterPro:IPR008625"
FT                   /db_xref="InterPro:IPR031320"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0CL80"
FT                   /protein_id="AAH81536.1"
FT                   /translation="MSWRGRSTYYWPRPRRYVQPPEMIGPMRPEQFSDEVEPATPEEGE
FT                   PATQRQDPAAAQEGEDEGASAGQGEKQSQC"
FT   misc_difference 394..414
FT                   /gene="GAGE7"
FT                   /gene_synonym="GAGE-7"
FT                   /note="polyA tail: 21 bases do not align to the human
FT                   genome."
XX
SQ   Sequence 414 BP; 131 A; 83 C; 106 G; 94 T; 0 other;
     tgtgaggcag tgctgtgtgg ttcctgccgt ccggactctt tttcctctac tgagattcat        60
     ctgtgtgaaa tatgagttgg cgaggaagat cgacctatta ttggcctaga ccaaggcgct       120
     atgtacagcc tcctgaaatg attgggccta tgcggcccga gcagttcagt gatgaagtgg       180
     aaccagcaac acctgaagaa ggggaaccag caactcaacg tcaggatcct gcagctgctc       240
     aggagggaga ggatgaggga gcatctgcag gtcaaggtga aaagcaatca cagtgttaaa       300
     agaagacacg ttgaaatgat gcaggctgct cctatgttgg aaatttgttc attaaaattc       360
     tcccaataaa gctttacagc cttctgcaaa gaaaaaaaaa aaaaaaaaaa aaaa             414
//

If you have problems or comments...

PBIL Back to PBIL home page