(data stored in ACNUC1829 zone)

EMBL: BC083070

ID   BC083070; SV 1; linear; mRNA; STD; MUS; 1479 BP.
XX
AC   BC083070;
XX
DT   30-SEP-2004 (Rel. 81, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 7)
XX
DE   Mus musculus tetraspanin 4, mRNA (cDNA clone MGC:102386 IMAGE:6314296),
DE   complete cds.
XX
KW   MGC.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1479
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-1479
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (24-SEP-2004) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; 7f04dc49d69576e272068c056e87af36.
DR   Ensembl-Gn; ENSMUSG00000025511; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0033236; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0033217; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0033150; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0033218; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0032933; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0033730; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0032263; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0032905; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0033057; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0033010; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0033152; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0033043; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0033749; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0031967; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0032373; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000026585; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000117634; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0087640; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0087726; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0087662; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0087681; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0087245; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0088186; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0087773; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0087187; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0087382; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0087226; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0087414; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0087265; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0088483; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0087172; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0086282; mus_musculus_wsbeij.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Susan L. Sullivan, PhD.
CC   cDNA Library Preparation: ResGen, Invitrogen Corp
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: National Institutes of Health Intramural
CC   Sequencing Center (NISC),
CC   Gaithersburg, Maryland;
CC   Web site: http://www.nisc.nih.gov/
CC   Contact: nisc_mgc@nhgri.nih.gov
CC   Akhter,N., Ayele,K., Beckstrom-Sternberg,S.M., Benjamin,B.,
CC   Blakesley,R.W., Bouffard,G.G., Breen,K., Brinkley,C., Brooks,S.,
CC   Dietrich,N.L., Granite,S., Guan,X., Gupta,J., Haghighi,P.,
CC   Hansen,N., Ho,S.-L., Karlins,E., Kwong,P., Laric,P., Legaspi,R.,
CC   Maduro,Q.L., Masiello,C., Maskeri,B., Mastrian,S.D.,McCloskey,J.C.,
CC   McDowell,J., Pearson,R., Stantripop,S., Thomas,P.J., Touchman,J.W.,
CC   Tsurgeon,C., Vogt,J.L., Walker,M.A., Wetherby,K.D., Wiggins,L.,
CC   Young,A., Zhang,L.-H. and Green,E.D.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAK Plate: 194 Row: e Column: 7
CC   This clone was selected for full length sequencing because it
CC   passed the following selection criteria: matched mRNA gi: 16716364.
CC   Differences found between this sequence and the mouse C57BL/6J
CC   genome (build 36) are described in misc_difference features below.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1479
FT                   /organism="Mus musculus"
FT                   /lab_host="DH10B"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NIH_MGC_129"
FT                   /clone="MGC:102386 IMAGE:6314296"
FT                   /tissue_type="Olfactory epithelium, neonatal mouse,
FT                   C57Bl/6"
FT                   /note="Vector: pCMV-SPORT6"
FT                   /db_xref="taxon:10090"
FT   gene            1..1479
FT                   /gene="Tspan4"
FT                   /note="synonyms: Tspan-4, NAG-2"
FT   CDS_pept        276..992
FT                   /codon_start=1
FT                   /gene="Tspan4"
FT                   /product="tetraspanin 4"
FT                   /db_xref="GOA:Q9DCK3"
FT                   /db_xref="InterPro:IPR000301"
FT                   /db_xref="InterPro:IPR008952"
FT                   /db_xref="InterPro:IPR018499"
FT                   /db_xref="InterPro:IPR018503"
FT                   /db_xref="MGI:MGI:1928097"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9DCK3"
FT                   /protein_id="AAH83070.1"
FT                   /translation="MARGCLQGVKYLMFAFNLLFWLGGCGVLGVGIWLAATQGNFATLS
FT                   SSFPSLSAANLLIVTGTFVMAIGFVGCIGALKENKCLLLTFFVLLLLVFLLEATIAVLF
FT                   FAYSDKIDSYAQQDLKKGLHLYGTQGNVGLTNAWSIIQTDFRCCGVSNYTDWFEVYNAT
FT                   RVPDSCCLEFSDSCGLHEPGTWWKSPCYETVKAWLQENLLAVGIFGLCTALVQILGLTF
FT                   AMTMYCQVVKADTYCA"
FT   misc_difference 1462..1479
FT                   /gene="Tspan4"
FT                   /note="polyA tail: 18 bases do not align to the mouse
FT                   genome."
XX
SQ   Sequence 1479 BP; 288 A; 436 C; 415 G; 340 T; 0 other;
     cgcatctccc tgaatcccgc cgcagccctg ccccggctcc catgattacc ctgaagcggc        60
     ggtgttcctt gctcgtgccc acccggggct ccgagagcct ccgagcccgc ggcagcatcc       120
     cggtcccccc cctcccgctg tggtggtaga tcccggcgct acggcgtccg agcaaggccg       180
     aaaggtccgc ggccggcggt tcgcgtttct cgtgttgcct tgactgacag ctgctccgcc       240
     gtgcggcggc gcgcacagag ctgaagcgct gcagcatggc gcgcggctgc ctccagggcg       300
     tcaagtacct catgttcgcc ttcaacctgc tcttctggct gggtggctgt ggtgtcctgg       360
     gtgttggcat ctggttggct gccacacagg gaaactttgc caccttatca tcctcatttc       420
     catccttgtc ggctgccaac ctgctcatcg tcaccgggac cttcgtcatg gccatcggct       480
     tcgtgggctg cattggggcc ctcaaggaga acaagtgcct actgctcact ttctttgtgc       540
     tgctgctgct agtgttcctg ctggaagcca ccattgctgt gctcttcttt gcctacagtg       600
     acaagattga cagttatgcc caacaagacc tgaagaaggg cctgcatctg tatggcacac       660
     agggcaacgt gggcctcacc aatgcctgga gcatcatcca gactgatttc cgatgctgtg       720
     gagtttccaa ttacactgat tggtttgagg tatacaatgc cactcgtgtg cctgactcct       780
     gctgtctgga gttcagtgat agctgtgggt tacatgaacc tggtacctgg tggaagtcgc       840
     cctgttatga gacagtgaag gcctggctcc aggagaacct gctagctgtg ggcatctttg       900
     gactgtgcac ggcactggtg cagattctgg gcctcacctt cgctatgacc atgtactgcc       960
     aggtggtaaa ggcggacacc tactgtgcat aggtctcaca gcctctgctt ctctgccaaa      1020
     ggacccgccc acgggaagga agatgtccaa acccgctccc cctgcaggac tggtgttctg      1080
     ctgaatgcag ggggaagagc tggaggccag agcacccagc atccatccct gcacctgagg      1140
     gcactctgct tgggtggcag cagacaccag actatagagt tggtgccaaa tggcacccag      1200
     ggctaagggc ccagggaact ttgacacttt ttatatccat atataccttc cagtgttcac      1260
     acaggatggg gttcccagcc ttgcatggtt gctaggttgg gggcaggccc agtctgctca      1320
     aggcccacga tgatcttggt gctccaggca gggccaggtc ccatgatcca cattccatga      1380
     cagtgtcgtg gttccagatg catcttaata aagtgtgtga gcagactgtg ggtcttgcca      1440
     acacacaaag gttgtacagc caaaaaaaaa aaaaaaaaa                             1479
//

If you have problems or comments...

PBIL Back to PBIL home page