(data stored in ACNUC23059 zone)

EMBL: BC083075

ID   BC083075; SV 1; linear; mRNA; STD; MUS; 1261 BP.
XX
AC   BC083075;
XX
DT   30-SEP-2004 (Rel. 81, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 7)
XX
DE   Mus musculus CDK2 (cyclin-dependent kinase 2)-associated protein 1, mRNA
DE   (cDNA clone IMAGE:6440764), complete cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1261
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-1261
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (24-SEP-2004) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; b5fcc98ebefcadc54698208f89e11aa7.
DR   Ensembl-Gn; ENSMUSG00000029394; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000078154; mus_musculus.
DR   Ensembl-Gn; MGP_C3HHeJ_G0029786; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0030522; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0029893; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0030563; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0028909; mus_musculus_pwkphj.
DR   Ensembl-Tr; ENSMUST00000031341; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000104959; mus_musculus.
DR   Ensembl-Tr; MGP_C3HHeJ_T0074066; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0074898; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0074061; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0075131; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0074064; mus_musculus_pwkphj.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Gilbert Smith, Ph.D.
CC   cDNA Library Preparation: Life Technologies, Inc.
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: National Institutes of Health Intramural
CC   Sequencing Center (NISC),
CC   Gaithersburg, Maryland;
CC   Web site: http://www.nisc.nih.gov/
CC   Contact: nisc_mgc@nhgri.nih.gov
CC   Akhter,N., Ayele,K., Beckstrom-Sternberg,S.M., Benjamin,B.,
CC   Blakesley,R.W., Bouffard,G.G., Breen,K., Brinkley,C., Brooks,S.,
CC   Dietrich,N.L., Granite,S., Guan,X., Gupta,J., Haghighi,P.,
CC   Hansen,N., Ho,S.-L., Karlins,E., Kwong,P., Laric,P., Legaspi,R.,
CC   Maduro,Q.L., Masiello,C., Maskeri,B., Mastrian,S.D.,McCloskey,J.C.,
CC   McDowell,J., Pearson,R., Stantripop,S., Thomas,P.J., Touchman,J.W.,
CC   Tsurgeon,C., Vogt,J.L., Walker,M.A., Wetherby,K.D., Wiggins,L.,
CC   Young,A., Zhang,L.-H. and Green,E.D.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAK Plate: 194 Row: g Column: 5
CC   This clone has the following problem: The cds is short compared to
CC   the longest cds in the locus.
CC   Differences found between this sequence and the mouse C57BL/6J
CC   genome (build 36) are described in misc_difference features below.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1261
FT                   /organism="Mus musculus"
FT                   /lab_host="DH10B"
FT                   /strain="FVB/N-3"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NCI_CGAP_Mam2"
FT                   /clone="IMAGE:6440764"
FT                   /tissue_type="Mammary tumor. MMTV-LTR/INT3 model. 5 month
FT                   old mouse. Taken by biopsy."
FT                   /note="Vector: pCMV-SPORT6"
FT                   /db_xref="taxon:10090"
FT   gene            1..1261
FT                   /gene="Cdk2ap1"
FT                   /note="synonyms: ST19, DORC1, doc-1, Apc10, Cdkap1"
FT   CDS_pept        255..599
FT                   /codon_start=1
FT                   /gene="Cdk2ap1"
FT                   /product="CDK2 (cyclin-dependent kinase 2)-associated
FT                   protein 1"
FT                   /db_xref="GOA:O35207"
FT                   /db_xref="InterPro:IPR017266"
FT                   /db_xref="MGI:MGI:1202069"
FT                   /db_xref="UniProtKB/Swiss-Prot:O35207"
FT                   /protein_id="AAH83075.1"
FT                   /translation="MSYKPNLTAHMPAAALNAGSVHSPSTSMATSSQYRQLLSDYGPPS
FT                   LGYTQGTGNSQVPQSKYAELLAIIEELGKEIRPTYAGSKSAMERLKRGIIHARSLVREC
FT                   LAETERNARS"
FT   misc_difference 1248..1261
FT                   /gene="Cdk2ap1"
FT                   /note="polyA tail: 14 bases do not align to the mouse
FT                   genome."
XX
SQ   Sequence 1261 BP; 284 A; 366 C; 341 G; 270 T; 0 other;
     gccgcccctg cgccgcgcgc ccgatgtatg ggtgatctac tgcggcggcg gcggcggcgg        60
     cggcggcagg gtgagggacg gccatatttg ccggcgcggc ccgagccggc gacaacaaaa       120
     agtgcgcggg ctcccggcgg gcgctcggac ggctgcgggg acgtggggcc gcccggcccg       180
     ggcctcggcc tcggcctcgc cggcgcgctc gcggcctggc ccggctctgc ccggcgcgcc       240
     cgccgcccgc ggggatgtcg tacaagccga acttgaccgc gcacatgccc gccgccgccc       300
     tcaacgccgg aagtgtccac tcaccctcta ctagcatggc gacctcctcc caatatcgcc       360
     agctgctgag tgactatggg cctccatcgc taggctacac ccagggaact ggaaatagcc       420
     aggtgcctca gagtaaatat gcagagctgc tggccatcat tgaagagttg gggaaagaga       480
     tcagaccgac gtatgcaggg agcaagagcg ccatggagag gctaaaacga ggcatcattc       540
     atgcccggag cctggttcgg gagtgcttgg ctgaaacgga acggaatgcc aggtcctagc       600
     ccctggctgg tctgaaggcc catctcacta ccccgtggag atgagaggct ttgtgcaaaa       660
     tggcagtcat ttttctacca cagtcattaa gctctgaacc cacactcaaa agattgggag       720
     gacattttgc agtaactgac gatgtgcatt ttaagtagtt aggaatgacc cagctctttt       780
     tttctttcca aacatttgaa agatgtttgt gaagccactt cacagcaagc tattgtttgt       840
     ccccaaatac cagtgtcccc tctaacctgc ctttggatac gcatcacccc agctgacttc       900
     ctttccctga gctcacctgc ctccgaggag ttgagtgcaa accacagcgc ctttgctcag       960
     tagctggccc gcctgtgtac agtgtagacc ctgcttcatg gagcttctct gcctaagcgt      1020
     ttgcatgact gagtgcttgg aagtcaatct ttaaaatgca caggttacac atgcagaaga      1080
     aagagccatc tacccaacct cccaagcacc ctgcagatgt ccatcctgag gctgtagatc      1140
     tcagttctgt gtttactgtg agcccatcac aacatctgga agaaagcgac tgaaactgtt      1200
     gcatctttgt atttattact tgatgtaata aagcttattt tcattaaaaa aaaaaaaaaa      1260
     a                                                                      1261
//

If you have problems or comments...

PBIL Back to PBIL home page