(data stored in ACNUC7421 zone)

EMBL: BC083204

ID   BC083204; SV 1; linear; mRNA; STD; VRT; 1258 BP.
XX
AC   BC083204;
XX
DT   02-OCT-2004 (Rel. 81, Created)
DT   21-OCT-2008 (Rel. 97, Last updated, Version 7)
XX
DE   Danio rerio zgc:101569, mRNA (cDNA clone MGC:101569 IMAGE:7222616),
DE   complete cds.
XX
KW   MGC.
XX
OS   Danio rerio (zebrafish)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
OC   Actinopterygii; Neopterygii; Teleostei; Ostariophysi; Cypriniformes;
OC   Cyprinidae; Danio.
XX
RN   [1]
RP   1-1258
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-1258
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (01-OCT-2004) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; 3f231a09722647abe87875d0bd98185e.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Will Talbot
CC   cDNA Library Preparation: Dr. Yutaka Suzuki and Dr. Sumio Sugano
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: Sequencing Group at the Stanford Human Genome
CC   Center, Stanford University School of Medicine, Stanford, CA  94305
CC   Web site:       http://www-shgc.stanford.edu
CC   Contact:  (Dickson, Mark) mcd@paxil.stanford.edu
CC   Dickson, M., Schmutz, J., Grimwood, J., Rodriquez, A., and Myers,
CC   R. M.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAK Plate: 197 Row: e Column: 7
CC   This clone was selected for full length sequencing because it
CC   passed the following selection criteria: matched mRNA gi: 53734076.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1258
FT                   /organism="Danio rerio"
FT                   /lab_host="DH10B"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NIH_ZGC_15"
FT                   /clone="MGC:101569 IMAGE:7222616"
FT                   /tissue_type="Embryo, whole, 2-8 hr, mixed wild type, pool
FT                   of 2500 embryos"
FT                   /note="Vector: pME18S-FL3"
FT                   /db_xref="taxon:7955"
FT   gene            1..1258
FT                   /gene="zgc:101569"
FT   CDS_pept        80..988
FT                   /codon_start=1
FT                   /gene="zgc:101569"
FT                   /product="zgc:101569"
FT                   /db_xref="GOA:Q5XJU1"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR018376"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XJU1"
FT                   /db_xref="ZFIN:ZDB-GENE-041010-72"
FT                   /protein_id="AAH83204.1"
FT                   /translation="MSVNSAFRRAILSLNYVKGQRFNSSTSNKERKTTSSGSNGPVVSE
FT                   RRGAVMLIGINRPEARNAVNRETAQRLTEELSAFDQDDSLNVAVLYGVGGNFCAGFDLK
FT                   ELAHGSDSLELEQDVSSGPGPMGPSRMRLSKPLIAAVSGYAVAGGLELALLADMRVAEE
FT                   SSIMGVFCRRFGVPLIDGGTVRLPQLIGLSRALDLILTGRPVKAHEALAFGLANRVVPD
FT                   GQALQEALELAEQVSAFPQLCLRADRNSAYHALFDSTSFNQAMQYETDNGIPVVIAEAV
FT                   AGAAKFSSGVGRGGTFSKSKL"
XX
SQ   Sequence 1258 BP; 351 A; 265 C; 316 G; 326 T; 0 other;
     accactttaa accacgcaaa acacagatga gacacacgtt aacagtttct ccttaattat        60
     ggctctaact ttagggagaa tgtcagttaa tagtgccttt aggagggcga tcctgagttt       120
     aaactacgtg aaaggacaaa gatttaacag cagcacttca aacaaggaaa gaaaaactac       180
     gagctcaggt tctaatggcc cagtagtttc tgagagaagg ggtgcagtga tgcttattgg       240
     gataaaccgt cctgaggcac gtaatgcagt gaatcgagag actgctcaga gactgaccga       300
     ggagctgtca gccttcgacc aggacgacag ccttaatgtg gcagtgctgt atggagtggg       360
     aggcaatttc tgcgctggat ttgatctgaa ggagttggcc catggttctg attctcttga       420
     acttgagcaa gatgtcagca gtggtcctgg tcccatgggt ccgtctcgta tgaggctctc       480
     aaagcccttg attgcagcag tcagtgggta tgctgtggct ggaggcctgg agctggcact       540
     gctggctgac atgagggtgg ccgaggagag ttctatcatg ggagttttct gccgcagatt       600
     tggtgtgcca ttgattgatg gaggtacagt gagactcccg cagctgattg gtctctctcg       660
     agcactagat ctcatcctca caggccgacc agtgaaggca catgaggctt tagcatttgg       720
     actggcaaac agagtagtcc ctgatggcca agcacttcaa gaggctcttg aactcgcaga       780
     acaggtcagc gcatttccac agctctgtct ccgtgctgac cgtaactccg cctaccatgc       840
     cctgtttgac tccacctcct tcaaccaggc catgcagtat gagacggata atggcatacc       900
     agtcgttata gctgaagctg ttgctggagc agcaaaattc agctcgggtg tcgggagagg       960
     tgggacgttc tccaagagta aactgtaaac agacaggtat tcagaaatga aatgtgtgtg      1020
     tgactaatta atactagtat tgatcattgt ataagcttta tggctatgtg cagtagttcc      1080
     aatacattga ataattgtgc ttaatccact tcaaagtgca tcttcaaatc gctcagcttt      1140
     ttttaaccgc tgtaaacaga atatgcattt gtaaatcact gtcgctgttt aaacagtata      1200
     tactgctgct gtattaaacg tcatattctg aaaaaaaaaa aaaaaaaaaa aaaaaaaa        1258
//

If you have problems or comments...

PBIL Back to PBIL home page