(data stored in ACNUC27637 zone)

EMBL: BC083529

ID   BC083529; SV 1; linear; mRNA; STD; VRT; 756 BP.
XX
AC   BC083529;
XX
DT   02-OCT-2004 (Rel. 81, Created)
DT   21-OCT-2008 (Rel. 97, Last updated, Version 4)
XX
DE   Danio rerio nuclear cap binding protein subunit 2, mRNA (cDNA clone
DE   MGC:92592 IMAGE:5913279), complete cds.
XX
KW   MGC.
XX
OS   Danio rerio (zebrafish)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
OC   Actinopterygii; Neopterygii; Teleostei; Ostariophysi; Cypriniformes;
OC   Cyprinidae; Danio.
XX
RN   [1]
RP   1-756
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-756
RA   Director MGC Project;
RT   ;
RL   Submitted (01-OCT-2004) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Cancer
RL   Genomics Office, National Cancer Institute, 31 Center Drive, Room 11A03,
RL   Bethesda, MD 20892-2590, USA
XX
DR   MD5; 9ff3306e8c457f1fd70b82763e9c9f87.
DR   Ensembl-Gn; ENSDARG00000014898; danio_rerio.
DR   Ensembl-Tr; ENSDART00000008365; danio_rerio.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Dr. Sumio Sugano
CC   cDNA Library Preparation: Dr. Sumio Sugano
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: Sequencing Group at the Stanford Human Genome
CC   Center, Stanford University School of Medicine, Stanford, CA  94305
CC   Web site:       http://www-shgc.stanford.edu
CC   Contact:  (Dickson, Mark) mcd@paxil.stanford.edu
CC   Dickson, M., Schmutz, J., Grimwood, J., Rodriquez, A., and Myers,
CC   R. M.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAK Plate: 180 Row: b Column: 13
CC   This clone was selected for full length sequencing because it
CC   passed the following selection criteria: matched mRNA gi: 53733380.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..756
FT                   /organism="Danio rerio"
FT                   /lab_host="DH10B"
FT                   /mol_type="mRNA"
FT                   /clone_lib="Sugano SJD adult male"
FT                   /clone="MGC:92592 IMAGE:5913279"
FT                   /tissue_type="Whole body, adult male"
FT                   /note="Vector: pME18S-FL3"
FT                   /db_xref="taxon:7955"
FT   gene            1..756
FT                   /gene="ncbp2"
FT                   /note="synonyms: CHUNP6917, zgc:92592"
FT   CDS_pept        93..560
FT                   /codon_start=1
FT                   /gene="ncbp2"
FT                   /product="ncbp2 protein"
FT                   /db_xref="GOA:Q8JGR6"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR027157"
FT                   /db_xref="InterPro:IPR034148"
FT                   /db_xref="InterPro:IPR035979"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8JGR6"
FT                   /db_xref="ZFIN:ZDB-GENE-020419-31"
FT                   /protein_id="AAH83529.1"
FT                   /translation="MSIKLNALFSDSYVDVSQYRDQHFKGNRYEQEKLLKQSATLYVGN
FT                   LSFYTTEEQVHELFAKCGDVKRIIIGLDKIKKTACGFCFVEYYTRADAENAMRFVNGTR
FT                   LDDRIIRTDWDAGFKEGRQYGWGKSGGQVRDEYRQDYDPARGGYGKMVQKS"
XX
SQ   Sequence 756 BP; 212 A; 159 C; 180 G; 205 T; 0 other;
     acatatgaag aagagcgctt tccgctttgt gtgtcgtgct gatttaaaca cgtccagctt        60
     cacttttcct caactaattt gcttttttca caatgtccat aaagttaaat gctcttttca       120
     gcgactccta tgttgatgtg agccaataca gggatcagca ttttaagggc aaccgttacg       180
     agcaggagaa gctcctcaaa cagagcgcca cgctgtatgt aggaaacctg tccttctaca       240
     ccacagagga gcaggtgcac gagctcttcg ccaagtgtgg agacgtcaag aggatcatca       300
     tcggcctcga caaaatcaag aagactgcgt gcggcttctg cttcgtcgaa tattacactc       360
     gtgcggacgc tgagaacgcc atgaggtttg tcaacggcac gcgtctggac gaccgcatca       420
     tcagaacaga ctgggacgca ggcttcaaag agggccgaca gtacggatgg gggaaatctg       480
     gtggtcaggt cagagatgaa tacaggcagg actatgatcc cgccagaggg ggttatggga       540
     agatggtgca gaaatcttga acatcccttt cgtcattttc cttttctttt tttaatcttt       600
     taaaatattt ccacgttatg aatgaatctg gcagattacg gctgttttct gaatgtacat       660
     atcggagttt gctttaggaa tcgctcaagt tcttctgatc cagcatgatg agtttaataa       720
     attgtgtttt gtaaagtaaa aaaaaaaaaa aaaaaa                                 756
//

If you have problems or comments...

PBIL Back to PBIL home page