(data stored in ACNUC10243 zone)

EMBL: BC085474

ID   BC085474; SV 1; linear; mRNA; STD; MUS; 1851 BP.
XX
AC   BC085474;
XX
DT   03-NOV-2004 (Rel. 81, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 4)
XX
DE   Mus musculus heterogeneous nuclear ribonucleoprotein A3, mRNA (cDNA clone
DE   MGC:101940 IMAGE:30538435), complete cds.
XX
KW   MGC.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1851
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-1851
RA   Director MGC Project;
RT   ;
RL   Submitted (01-NOV-2004) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Cancer
RL   Genomics Office, National Cancer Institute, 31 Center Drive, Room 11A03,
RL   Bethesda, MD 20892-2590, USA
XX
DR   MD5; e61fa0d97002c3cc36c25fbcd62d9c97.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Dr. Jim Lin, University of Iowa
CC   cDNA Library Preparation: M. Bento Soares, University of Iowa
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: Sequencing Group at the Stanford Human Genome
CC   Center, Stanford University School of Medicine, Stanford, CA  94305
CC   Web site:       http://www-shgc.stanford.edu
CC   Contact:  (Dickson, Mark) mcd@paxil.stanford.edu
CC   Dickson, M., Schmutz, J., Grimwood, J., Rodriquez, A., and Myers,
CC   R. M.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAK Plate: 195 Row: m Column: 8.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1851
FT                   /organism="Mus musculus"
FT                   /lab_host="DH10B"
FT                   /strain="C57BL/6"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NIH_BMAP_GW0"
FT                   /clone="MGC:101940 IMAGE:30538435"
FT                   /tissue_type="Eye"
FT                   /note="Vector: pYX-ASC"
FT                   /db_xref="taxon:10090"
FT   gene            1..1851
FT                   /gene="Hnrpa3"
FT                   /note="synonyms: MGC37309, hnRNPA3"
FT   CDS_pept        133..1074
FT                   /codon_start=1
FT                   /gene="Hnrpa3"
FT                   /product="Hnrpa3 protein"
FT                   /db_xref="GOA:Q5U3M2"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR034516"
FT                   /db_xref="InterPro:IPR035979"
FT                   /db_xref="MGI:MGI:1917171"
FT                   /db_xref="UniProtKB/TrEMBL:Q5U3M2"
FT                   /protein_id="AAH85474.1"
FT                   /translation="MRDPQTKRSRGFGFVTYSCVEEVDAAMCARPHKVDGRVVEPKRAV
FT                   SREDSVKPGAHLTVKKIFVGGIKEDTEEYNLRDYFEKYGKIETIEVMEDRQSGKKRGFA
FT                   FVTFDDHDTVDKIVVQKYHTINGHNCEVKKALSKQEMQSAGSQRGRGGGSGNFMGRGGN
FT                   FGGGGGNFGRGGNFGGRGGYGGGGGGSRGSYGGGDGGYNGFGGDGGNYGGGPGYSSRGG
FT                   YGGGGPGYGNQGGGYGGGGGGYDGYNEGGNFGGGNYGGGGNYNDFGNYSGQQQSNYGPM
FT                   KGGSFGGRSSGSPYGGGYGSGGGSGGYGSRRF"
XX
SQ   Sequence 1851 BP; 592 A; 235 C; 506 G; 518 T; 0 other;
     aaatggaggg ccatgatcca aaggaaccag agcagctgag gaagctattt attggtggtc        60
     tgagctttga aaccacagat gatagcttaa gagaacattt tgagaaatgg ggcacactta       120
     cagactgtgg taatgagaga tccccaaaca aaacgttcca gaggctttgg ttttgtgacc       180
     tactcttgtg ttgaagaggt ggatgctgca atgtgtgctc ggccacacaa ggttgatggg       240
     cgtgtggtgg aaccgaagag agctgtttct agagaggatt ctgtaaagcc tggtgcccat       300
     ttaacggtga agaaaatttt tgttggtggt attaaagagg atacggaaga atataacctg       360
     agagactact ttgaaaagta tggcaagatt gaaaccatag aggttatgga agacaggcag       420
     agtgggaaaa agagaggatt tgcttttgta acttttgatg atcatgacac agttgataaa       480
     attgttgttc agaaatacca cactattaat gggcataatt gtgaagtgaa aaaggccctt       540
     tctaaacaag agatgcagtc tgctggatca cagagaggtc gtggaggtgg atctggcaac       600
     tttatgggtc gtggaggaaa ctttggaggt ggtggaggaa actttggtcg tggaggaaac       660
     tttggtggaa gaggtggcta tggtggtgga ggtggtggca gcagaggtag ttatggaggt       720
     ggtgatggtg gatataatgg atttggaggt gatggtggca actatggtgg tggtcctggt       780
     tacagcagta gaggaggtta tggaggtggt ggaccaggat atggaaacca gggtggtgga       840
     tatggtggtg gaggaggagg ctatgatggt tacaatgaag gaggaaattt tggtggaggt       900
     aactatggtg gtggtggaaa ctataatgac tttggaaatt atagtggaca gcaacaatca       960
     aattatggac ccatgaaggg gggcagtttt ggtggaagaa gctcaggcag tccctatggt      1020
     ggtggctatg gatctggagg tggaagtggt ggatatggta gcagaaggtt ttaaaataaa      1080
     acagaaacgg ctacagttct tagcaggaga gagagcgagg agttgtcagg aaagctgcag      1140
     gttactttga gacagtcgtc ccaaatgcat tagaggaact gtaaaaatct gccacagaag      1200
     gaacgatgat ccatagtcag aaaagttact gcagcttaaa caggaaaccc ttcttgttca      1260
     gactgtcata gccacagttt gcaaaaagtg cagctattga ttaatgcaat gtagtgtcaa      1320
     ttagatgtac attcctgagg tcttttatct gttgtagctt tgtctttttc tttttctttt      1380
     cattacatca ggtatattgc cctgtaaatt gtggtagtgg taccaggaat aaaaaattaa      1440
     ggaattttta acttttcaat atttgtgtag ttcagttttt ctacatttta gtacagaaac      1500
     tttaacaaaa tgcagtttcg aaggtgtttc cttgtgagtt aacacgtgaa gaagatcatt      1560
     gttaattact attttgtatg aattttgcta aagttaactg taaagaaaca cctactgact      1620
     tgcaatttaa ggggaatcta ttctccccat ttccaaaaca atgatgaatg ggcgctgaca      1680
     tgtggagaga atagatattt gtatgtttgc aatgtgtgtt ttagataatt agaattggga      1740
     aataaaaaaa tagcatattt gtgaatttaa tagcattaag attaccttca aatgaaaaag      1800
     atctcaaaag ttaaaaaaaa aaaaaaaaaa aaaaaaaaaa aaaaaaaaaa a               1851
//

If you have problems or comments...

PBIL Back to PBIL home page