(data stored in ACNUC16935 zone)

EMBL: BC089218

ID   BC089218; SV 1; linear; mRNA; STD; ROD; 2083 BP.
XX
AC   BC089218;
XX
DT   05-FEB-2005 (Rel. 82, Created)
DT   17-APR-2005 (Rel. 83, Last updated, Version 4)
XX
DE   Rattus norvegicus ubiquitin C, mRNA (cDNA clone IMAGE:7312282), partial
DE   cds.
XX
KW   .
XX
OS   Rattus norvegicus (Norway rat)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Rattus.
XX
RN   [1]
RP   1-2083
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-2083
RA   Director MGC Project;
RT   ;
RL   Submitted (31-JAN-2005) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Cancer
RL   Genomics Office, National Cancer Institute, 31 Center Drive, Room 11A03,
RL   Bethesda, MD 20892-2590, USA
XX
DR   MD5; 18ae29b7fe4044ee625330b4ad01a62a.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Drs. Josef Lazar  & Howard Jacob, Medical
CC   College of Wisconsin
CC   cDNA Library Preparation: Express Genomics
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: National Institutes of Health Intramural
CC   Sequencing Center (NISC),
CC   Gaithersburg, Maryland;
CC   Web site: http://www.nisc.nih.gov/
CC   Contact: nisc_mgc@nhgri.nih.gov
CC   Akhter,N., Ayele,K., Beckstrom-Sternberg,S.M., Benjamin,B.,
CC   Blakesley,R.W., Bouffard,G.G., Breen,K., Brinkley,C., Brooks,S.,
CC   Dietrich,N.L., Granite,S., Guan,X., Gupta,J., Haghighi,P.,
CC   Hansen,N., Ho,S.-L., Karlins,E., Kwong,P., Laric,P., Legaspi,R.,
CC   Maduro,Q.L., Masiello,C., Maskeri,B., Mastrian,S.D.,McCloskey,J.C.,
CC   McDowell,J., Pearson,R., Stantripop,S., Thomas,P.J., Touchman,J.W.,
CC   Tsurgeon,C., Vogt,J.L., Walker,M.A., Wetherby,K.D., Wiggins,L.,
CC   Young,A., Zhang,L.-H. and Green,E.D.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAK Plate: 203 Row: f Column: 23
CC   This clone was selected for full length sequencing because it
CC   passed the following selection criteria: matched mRNA gi: 8394501.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2083
FT                   /organism="Rattus norvegicus"
FT                   /lab_host="DH10B"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NIH_MGC_254"
FT                   /clone="IMAGE:7312282"
FT                   /tissue_type="Brain, rat"
FT                   /note="Vector: pExpress1"
FT                   /db_xref="taxon:10116"
FT   gene            <1..2083
FT                   /gene="Ubc"
FT   CDS_pept        <1..1972
FT                   /codon_start=2
FT                   /gene="Ubc"
FT                   /product="Ubc protein"
FT                   /db_xref="InterPro:IPR000626"
FT                   /db_xref="InterPro:IPR019954"
FT                   /db_xref="InterPro:IPR019956"
FT                   /db_xref="InterPro:IPR029071"
FT                   /db_xref="UniProtKB/TrEMBL:Q5FWT0"
FT                   /protein_id="AAH89218.1"
FT                   /translation="IFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAG
FT                   KQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKI
FT                   QDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTI
FT                   TLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLR
FT                   LRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRT
FT                   LSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPP
FT                   DQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSD
FT                   TIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIF
FT                   VKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQK
FT                   ESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFA
FT                   GKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLDVEPSVNTKKVKQE
FT                   DTRTFLTTVSRKSPSCACSWV"
XX
SQ   Sequence 2083 BP; 580 A; 592 C; 549 G; 362 T; 0 other;
     gatctttgtg aagaccctga caggcaagac catcaccctg gaggtcgagc ccagtgacac        60
     cattgaaaat gtcaaggcaa agatccagga caaggagggc atcccccctg accagcagag       120
     gctgatcttt gcaggcaagc agctggaaga tggccgcacc ctgtcagact acaacatcca       180
     gaaggagtcc accttgcacc tggtccttcg cctcagaggg ggcatgcaga tctttgtgaa       240
     gaccctgaca ggcaagacca tcaccctgga ggtcgagccc agtgacacca ttgaaaatgt       300
     caaggcaaag atccaggaca aggagggcat cccccctgac cagcagaggc tgatctttgc       360
     aggcaagcag ctggaagatg gccgcaccct gtcagattac aacatccaga aggagtccac       420
     cctgcacctg gtccttcgcc tcagaggggg catgcagatc tttgtgaaga ccctgacagg       480
     caagaccatc accctggagg tcgagcccag tgacaccatt gaaaatgtca aggcaaagat       540
     ccaggacaag gagggcatcc cccctgacca gcagaggctg atctttgcag gcaagcagct       600
     ggaagatggc cgcaccctgt cagactacaa catccagaag gagtccaccc tgcacctggt       660
     ccttcgcctc agagggggca tgcagatctt tgtgaagacc ctgacaggca agaccatcac       720
     cctggaggtc gagcccagtg acaccattga aaatgtcaag gcaaagatcc aggacaagga       780
     gggcatcccc cctgaccagc agaggctgat ctttgcaggc aagcagctgg aagatggccg       840
     caccctgtct gactacaaca tccagaagga gtccaccctg cacctggtcc tgcgcctcag       900
     agggggcatg cagatctttg tgaagaccct gacaggcaag accatcaccc tggaggtcga       960
     gcccagtgac accattgaaa atgtcaaggc aaagatccag gacaaggagg gcatcccccc      1020
     tgaccagcag aggctgatct ttgcaggcaa gcagctggaa gatggccgca ccctgtcaga      1080
     ctacaacatc cagaaggagt ccaccttgca cctggtcctt cgcctcagag ggggcatgca      1140
     gatctttgtg aagaccctga caggcaagac catcaccctg gaggtcgagc ccagtgacac      1200
     cattgaaaat gtcaaggcaa agatccagga caaggagggc atcccccctg accagcagag      1260
     gctgatcttt gcaggcaagc agctggaaga tggccgcacc ctgtctgact acaacatcca      1320
     gaaggagtcc accctgcacc tggtcctgcg cctcagaggg ggcatgcaga tctttgtgaa      1380
     gaccctgaca ggcaagacca tcaccctgga ggtcgagccc agtgacacca ttgaaaatgt      1440
     caaggcaaag atccaggaca aggagggcat cccccctgac cagcagaggc tgatctttgc      1500
     aggcaagcag ctggaagatg gccgcaccct gtcagactac aacatccaga aggagtccac      1560
     cctgcacctg gtccttcgcc tcagaggggg catgcagatc tttgtgaaga ccctgacagg      1620
     caagaccatc accctggagg tcgagcccag tgacaccatt gaaaatgtca aggcaaagat      1680
     ccaggacaag gagggcatcc cccctgacca gcagaggctg atctttgcag gcaagcagct      1740
     ggaagatggc cgcaccctgt cagactacaa catccagaag gagtccaccc tgcacctggt      1800
     cctgcgcctc agagggggca tgcagatctt tgtgaagacc ctgacaggca agaccatcac      1860
     tctggatgtc gagcccagtg ttaacaccaa gaaggtcaaa caggaagata ctcgtacctt      1920
     tctcaccaca gtatctagaa agagcccttc ttgtgcttgt tcttgggttt gatggggagg      1980
     tgtcttagtt ttccctatct tttaagctgt taacaagttt cattgcactt tgaataaagt      2040
     tcttgcattc ccaaaaaaaa aaaaaaaaaa aaaaaaaaaa agg                        2083
//

If you have problems or comments...

PBIL Back to PBIL home page