(data stored in ACNUC8465 zone)

EMBL: BC089688

ID   BC089688; SV 1; linear; mRNA; STD; VRT; 1687 BP.
XX
AC   BC089688;
XX
DT   03-FEB-2005 (Rel. 82, Created)
DT   27-JUN-2007 (Rel. 92, Last updated, Version 5)
XX
DE   Xenopus tropicalis ras homolog gene family, member U, mRNA (cDNA clone
DE   MGC:107947 IMAGE:7025085), complete cds.
XX
KW   MGC.
XX
OS   Xenopus tropicalis (tropical clawed frog)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Amphibia;
OC   Batrachia; Anura; Pipoidea; Pipidae; Xenopodinae; Xenopus; Silurana.
XX
RN   [1]
RP   1-1687
RX   DOI; 10.1002/dvdy.10174.
RX   PUBMED; 12454917.
RA   Klein S.L., Strausberg R.L., Wagner L., Pontius J., Clifton S.W.,
RA   Richardson P.;
RT   "Genetic and genomic tools for Xenopus research: The NIH Xenopus
RT   initiative";
RL   Dev. Dyn. 225(4):384-391(2002).
XX
RN   [2]
RP   1-1687
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [3]
RC   NIH-MGC Project
RP   1-1687
RA   Klein S., Gerhard D.S.;
RT   ;
RL   Submitted (01-FEB-2005) to the INSDC.
RL   National Institutes of Health, Xenopus Gene Collection (XGC), National
RL   Institute of Child Health and Human Development, 6100 Executive Boulevard,
RL   Room 4B01, Rockville, MD 20892-7510, USA
XX
DR   MD5; e426bb7d97e4226b202dbf49ee7cfda0.
XX
CC   Contact: XGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Rob Granger, University of Virginia
CC   cDNA Library Preparation: Open Biosystems
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: Sequencing Group at the Stanford Human Genome
CC   Center, Stanford University School of Medicine, Stanford, CA  94305
CC   Web site:       http://www-shgc.stanford.edu
CC   Contact:  (Dickson, Mark) mcd@paxil.stanford.edu
CC   Dickson, M., Schmutz, J., Grimwood, J., Rodriquez, A., and Myers,
CC   R. M.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAK Plate: 213 Row: o Column: 1
CC   This clone was selected for full length sequencing because it
CC   passed the following selection criteria: matched mRNA gi: 58477339.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1687
FT                   /organism="Xenopus tropicalis"
FT                   /lab_host="DH10B"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NICHD_XGC_Swb1N"
FT                   /clone="MGC:107947 IMAGE:7025085"
FT                   /tissue_type="Whole body, male, 10 months old, strain F6,
FT                   normal"
FT                   /note="Vector: pExpress1"
FT                   /db_xref="taxon:8364"
FT   gene            1..1687
FT                   /gene="rhou"
FT   CDS_pept        253..777
FT                   /codon_start=1
FT                   /gene="rhou"
FT                   /product="ras homolog gene family, member U"
FT                   /db_xref="GOA:Q5FVZ9"
FT                   /db_xref="InterPro:IPR001806"
FT                   /db_xref="InterPro:IPR003578"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q5FVZ9"
FT                   /protein_id="AAH89688.1"
FT                   /translation="MIFPHWCKFENTPVKLQLCDTAGQDEFDKLRHFCYPRTDVLILCF
FT                   SVVSPSSFQNISEKWISEIQCHCPHVPVVLVGTQCDLREDVKVLIQLARYQEKPVSNSS
FT                   ARALAEKIGAVAYVECSALTQKNLKEVFDTAIISGLRYSDLRGQRERKMAATANKMKTL
FT                   SKAWWKKYVCV"
XX
SQ   Sequence 1687 BP; 482 A; 338 C; 375 G; 492 T; 0 other;
     cagctctcgc ttggtttatg cagacgggtc atatctgaga agacatgccc cctcaagaac        60
     tttccgtgga ttacacttcc cactttgcac cccctgtgcc accccacaag cccaagcctg       120
     tgccagagtg ctgcggccag gagcggatcc ttaaatgcgt gctgctcggg gatggggcag       180
     ttggcaagac cagccttcta gttagttaca ccacaaacgg ctacccgacc cgctacatcc       240
     ctacggcttt cgatgatttt tccgcactgg tgcaagtttg aaaatactcc tgtgaaactt       300
     cagctctgtg atacagcagg acaggatgag tttgacaagc tacgtcattt ctgttatcca       360
     aggacagatg tactgattct gtgcttcagt gttgtcagcc cgtcctcctt tcagaatatc       420
     tctgaaaagt ggatatcaga gatacagtgc cactgtcccc atgtgccagt tgtactagtg       480
     gggactcagt gtgacctccg tgaagatgtc aaagttctca ttcagcttgc tcggtaccag       540
     gagaaacctg tgtctaactc ttctgctagg gctcttgctg aaaagatagg cgctgtagcc       600
     tatgtggagt gttcggcttt gacccagaag aacctaaaag aagtttttga tacagcaata       660
     atttcaggtt tgcgctactc ggatttaagg ggacagagag agaggaaaat ggctgccact       720
     gccaacaaga tgaaaactct ttcaaaggca tggtggaaaa agtatgtgtg tgtttgaggg       780
     taagagccat acttcatggt ggacacagag gaccaatatg cctgacttcc tgctgatgtg       840
     ttggcagcta agtagcacaa catttttttt ctgcaggaag ctggaattga aggagaagta       900
     gaggagtctt attttttttg ctgccaattt atagataaac tctttccaag agaagcaatg       960
     aaaccttttt ttccaacttg atcaagattc aaactatgga catctctcac ttgcaagaaa      1020
     aaaagatgtt tatggactaa tttctccctc ccaaagaact gaacaggaaa tgcatagtat      1080
     gaaagcaaga tacaccttta gctcctgtga acactgggca gggattgctg ctgtttgtta      1140
     ttacaaaggt cgaggccttg gtccatatca gaaaaggaga tattttgctg gtttatttaa      1200
     tttggctcct agctgaggtg gatgttattt caatacagct tctgttttaa gaagcgtgca      1260
     gtattttaag atattaacac tggtggatgc catgtgtatg tgttgtggag ggctctagag      1320
     gctttacctt tttgttgtac taaaaagatt atataatgat atagttggtg ccagtgataa      1380
     tatatgaggc gatatacagc tgttcatgaa ctacaattcc taacaaccat gggggattta      1440
     tatttaaaaa gcatggggga gtccaactag tgacttccag ctgcttataa ccctgacttc      1500
     agcctttgta atattttttt caatgtaact agttccctct gcatcgcaat ccatgctcca      1560
     tgacataata ctcttgttat atctgcttta taagcagctg cttgggagaa cactttgatg      1620
     tgattttgtt ttggaaataa aattacattt ataaaataaa aaaaaaaaaa aaaaaaaaaa      1680
     aaaaaaa                                                                1687
//

If you have problems or comments...

PBIL Back to PBIL home page