(data stored in ACNUC10083 zone)

EMBL: BC091969

ID   BC091969; SV 1; linear; mRNA; STD; VRT; 2289 BP.
XX
AC   BC091969;
XX
DT   26-MAR-2005 (Rel. 83, Created)
DT   21-OCT-2008 (Rel. 97, Last updated, Version 5)
XX
DE   Danio rerio chloride channel 7, mRNA (cDNA clone IMAGE:7154411), partial
DE   cds.
XX
KW   .
XX
OS   Danio rerio (zebrafish)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
OC   Actinopterygii; Neopterygii; Teleostei; Ostariophysi; Cypriniformes;
OC   Cyprinidae; Danio.
XX
RN   [1]
RP   1-2289
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-2289
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (14-MAR-2005) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; 948445bdd62992658bbeec12714d1b65.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Genome Institute of Singapore
CC   cDNA Library Preparation: S. Mathavan, Chia-Lin Wei, and Yijun
CC   Ruan, Genome Institute of Singapore
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: National Institutes of Health Intramural
CC   Sequencing Center (NISC),
CC   Gaithersburg, Maryland;
CC   Web site: http://www.nisc.nih.gov/
CC   Contact: nisc_mgc@nhgri.nih.gov
CC   Akhter,N., Ayele,K., Beckstrom-Sternberg,S.M., Benjamin,B.,
CC   Blakesley,R.W., Bouffard,G.G., Breen,K., Brinkley,C., Brooks,S.,
CC   Dietrich,N.L., Granite,S., Guan,X., Gupta,J., Haghighi,P.,
CC   Hansen,N., Ho,S.-L., Karlins,E., Kwong,P., Laric,P., Legaspi,R.,
CC   Maduro,Q.L., Masiello,C., Maskeri,B., Mastrian,S.D.,McCloskey,J.C.,
CC   McDowell,J., Pearson,R., Stantripop,S., Thomas,P.J., Touchman,J.W.,
CC   Tsurgeon,C., Vogt,J.L., Walker,M.A., Wetherby,K.D., Wiggins,L.,
CC   Young,A., Zhang,L.-H. and Green,E.D.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAL Plate: 66 Row: n Column: 11.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2289
FT                   /organism="Danio rerio"
FT                   /lab_host="DH10B"
FT                   /strain="Singapore local strain"
FT                   /mol_type="mRNA"
FT                   /clone_lib="GISZF001_ra"
FT                   /clone="IMAGE:7154411"
FT                   /tissue_type="Embryo, 7 different stages (from just
FT                   fertilized embryos to 72 hours just hatched baby fish)"
FT                   /note="Vector: pDNR-LIB"
FT                   /db_xref="taxon:7955"
FT   gene            <1..2289
FT                   /gene="clcn7"
FT                   /note="synonyms: im:7155923, zgc:153490"
FT   CDS_pept        <1..778
FT                   /codon_start=2
FT                   /gene="clcn7"
FT                   /product="clcn7 protein"
FT                   /db_xref="GOA:Q58ED2"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR001807"
FT                   /db_xref="InterPro:IPR014743"
FT                   /db_xref="UniProtKB/TrEMBL:Q58ED2"
FT                   /db_xref="ZFIN:ZDB-GENE-061103-196"
FT                   /protein_id="AAH91969.1"
FT                   /translation="GIGAAAQLGGIVRMTLSLTVILVEATGNVTYGFPIMLVLMTAKIV
FT                   GDYFVEGLYDIHIKLQSVPFLHWEAPPTSHWLTAREVMSSQVTCFNRIEKVGTIVDVLS
FT                   NTSTNHNGFPVVTHVTEIDEPSKLCGLVLRSQLIVLLKHKVFVERASSRFSQRKLQLKD
FT                   FRDAYPRFPPIQSIHVSQDERECMMDLTEFMNPTPYTVPQETSLPRVFKLLRALGLRHL
FT                   VVVDNENRVVGLVTRKDLARYHLGKDGLEELQLAQT"
XX
SQ   Sequence 2289 BP; 659 A; 448 C; 467 G; 715 T; 0 other;
     ggggatcggg gctgcagccc aacttggtgg cattgtccga atgaccctca gtctcacagt        60
     tattctggta gaagccactg ggaatgtgac ctatggcttt cccatcatgc ttgtgctaat       120
     gactgccaag attgttgggg attattttgt agagggcctg tatgacatcc atattaagct       180
     gcagagtgtt cctttcctcc actgggaggc tcctcctacg tctcattggc tgacggccag       240
     agaggtcatg agttctcaag tcacctgctt caacagaata gagaaggtcg gaaccattgt       300
     agatgtcctc agcaacactt ccaccaatca caatggcttc ccagtggtca cccatgttac       360
     tgagattgac gagccaagca aactctgtgg gcttgttctc cgctctcagc tcattgtcct       420
     tctcaaacat aaggtgtttg tggagagagc atcttcacgt ttcagccaaa ggaagctaca       480
     gctgaaggac ttcagagacg cgtatccacg tttccctcct attcagtcca tccacgtctc       540
     tcaggatgag agggagtgta tgatggacct gaccgagttc atgaacccaa cgccatacac       600
     tgttcctcag gagacttccc tcccccgtgt gtttaaattg cttcgggctc taggactccg       660
     acatctggtg gtggttgata atgagaacag ggttgtgggt ctagtaacca ggaaggacct       720
     tgcacgatac cacctgggta aagacggcct ggaggagctt cagctggcac agacatgatc       780
     agtcttcatg ttcaccttca ccagccttca gagcaccagc tttacaccgt aagaactcag       840
     ggctggttag agtcaaagat gccaaacaca aacctgcaac atgcacaagt gttccaacat       900
     tcagtattaa gggctcgatt atttaaaaaa cacacacaca cacacattta tcacaatcta       960
     agtctttatg cattcatttt tgcttgtaga aatacagcag agtgagcaca ttatgctagt      1020
     atgagatgtt agttttgcac tatgtgactg tttatttatt acatttcaga tattttagtg      1080
     tcgatgatct ttttgggagc cctctgtttt catgcctatc caaaaagcat tatgtctttg      1140
     gtttattaca tggctagcaa ggctagttac cactagtttt catgcctatt gcaaagtata      1200
     ttgacataaa aatgtgtcgg tatgcattgc attttccaca ttgtttggta tatttttgtg      1260
     tttacaacat ttcctgcaca attttaatga tcgacacttg tgttgaattg tggtgtttaa      1320
     aaatattcat catcagtgtg cagtttgctg atatggaata caatgcaatc tacattcgta      1380
     gcgtcaaagc atgggtttca aactgaattt ctggagtgac gcagctctgc agttttgctc      1440
     caatcctaat aaaacacaat caaggtgttc gagactcttt taaacaactt gatcattttg      1500
     attagctgtg tttgattagg gttggagcaa aaccttgcgg agctgtggcc ctccaggaat      1560
     tgagtttgag atccatgcat taaagggaca attcaccccc aaaaattcaa agaaaaaaaa      1620
     aagggtgcac tgtcccttta agaagcctat tggtgatacc tttatgtgca cttaaaacag      1680
     actactacat attatattgt tacaaacatg caaaaatggt tccttttttt gtttatctag      1740
     tgttgtttag gattttttaa atgtttgtgt ctagatttat caatttaatt gctatcaaaa      1800
     ataattgagg gtagatcagg ccctaaaacg aaaggcatca attctatttg tctcatgctt      1860
     cttggcattt gcaaggtttt tggtacgagt ttggaaaaaa gccagcggtt ttatgtagag      1920
     tttgtctcta cagaatgtga atttttgcca tgagctgcat ttgttttctg tgaaaatctg      1980
     tactttaaaa tgaaaaaaaa atcacagtat taaaaaaatg aagtatgatt atgcttaaac      2040
     gattgccaag cactgatcaa atgaaacatc tttaaatgaa gcgtgtaaac attgtccggt      2100
     ttagtctgct aagaagtctt gtataaagcc aatttgttgt ttttattgat caatggtctt      2160
     tctctctgct gatctctgct ttttatatgg ctgctgattt gaagttaaaa aatgatttta      2220
     taacaattta aacaagtttg tgaactaata aagctatgaa tgcaaaaaaa aaaaaaaaaa      2280
     aaaaaaaaa                                                              2289
//

If you have problems or comments...

PBIL Back to PBIL home page