(data stored in ACNUC10243 zone)

EMBL: BC092083

ID   BC092083; SV 1; linear; mRNA; STD; MUS; 1202 BP.
XX
AC   BC092083;
XX
DT   31-MAR-2005 (Rel. 83, Created)
DT   22-MAY-2005 (Rel. 83, Last updated, Version 2)
XX
DE   Mus musculus heterogeneous nuclear ribonucleoprotein A3, mRNA (cDNA clone
DE   IMAGE:4985180), partial cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1202
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-1202
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (19-MAR-2005) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; 09d28afe319ed8b68677e51fd389e6dd.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Jeffrey E. Green, M.D.
CC   cDNA Library Preparation: Life Technologies, Inc.
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: National Institutes of Health Intramural
CC   Sequencing Center (NISC),
CC   Gaithersburg, Maryland;
CC   Web site: http://www.nisc.nih.gov/
CC   Contact: nisc_mgc@nhgri.nih.gov
CC   Akhter,N., Ayele,K., Beckstrom-Sternberg,S.M., Benjamin,B.,
CC   Blakesley,R.W., Bouffard,G.G., Breen,K., Brinkley,C., Brooks,S.,
CC   Dietrich,N.L., Granite,S., Guan,X., Gupta,J., Haghighi,P.,
CC   Hansen,N., Ho,S.-L., Karlins,E., Kwong,P., Laric,P., Legaspi,R.,
CC   Maduro,Q.L., Masiello,C., Maskeri,B., Mastrian,S.D.,McCloskey,J.C.,
CC   McDowell,J., Pearson,R., Stantripop,S., Thomas,P.J., Touchman,J.W.,
CC   Tsurgeon,C., Vogt,J.L., Walker,M.A., Wetherby,K.D., Wiggins,L.,
CC   Young,A., Zhang,L.-H. and Green,E.D.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAK Plate: 193 Row: k Column: 17.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1202
FT                   /organism="Mus musculus"
FT                   /lab_host="DH10B"
FT                   /strain="FVB/N"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NCI_CGAP_Co24"
FT                   /clone="IMAGE:4985180"
FT                   /tissue_type="Colon, normal. 5 month old male mouse."
FT                   /note="Vector: pCMV-SPORT6"
FT                   /db_xref="taxon:10090"
FT   gene            <1..1202
FT                   /gene="Hnrpa3"
FT                   /note="synonyms: MGC37309, hnRNPA3"
FT   CDS_pept        <1..794
FT                   /codon_start=3
FT                   /gene="Hnrpa3"
FT                   /product="Hnrpa3 protein"
FT                   /db_xref="GOA:Q58E39"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR034516"
FT                   /db_xref="InterPro:IPR035979"
FT                   /db_xref="MGI:MGI:1917171"
FT                   /db_xref="UniProtKB/TrEMBL:Q58E39"
FT                   /protein_id="AAH92083.1"
FT                   /translation="VKPGAHLTVKKIFVGGIKEDTEEYNLRDYFEKYGKIETIEVMEDR
FT                   QSGKKRGFAFVTFDDHDTVDKIVVQKYHTINGHNCEVKKALSKQEMQSAGSQRGRGGGS
FT                   GNFMGRGGNFGGGGGNFGRGGNFGGRGGYGGGGGGSRGSYGGGDGGYNGFGGDGGNYGG
FT                   GPGYSSRGGYGGGGPGYGNQGGGYGGGGGGYDGYNEGGNFGGGNYGGGGNYNDFGNYSG
FT                   QQQSNYGPMKGGSFGGRSSGSPYGGGYGSGGGSGGYGSRRF"
XX
SQ   Sequence 1202 BP; 372 A; 146 C; 359 G; 325 T; 0 other;
     ctgtaaagcc tggtgcccat ttaacggtga agaaaatttt tgttggtggt attaaagagg        60
     atacggaaga atataacctg agagactact ttgaaaagta tggcaagatt gaaaccatag       120
     aggttatgga agacaggcag agtgggaaaa agagaggatt tgcttttgta acttttgatg       180
     atcatgacac agttgataaa attgttgttc agaaatacca cactattaat gggcataatt       240
     gtgaagtgaa aaaggccctt tctaaacaag agatgcagtc tgctggatca cagagaggtc       300
     gtggaggtgg atctggcaac tttatgggtc gtggaggaaa ctttggaggt ggtggaggaa       360
     actttggtcg tggaggaaac tttggtggaa gaggtggcta tggtggtgga ggtggtggca       420
     gcagaggtag ttatggaggt ggtgatggtg gatataatgg atttggaggt gatggtggca       480
     actatggtgg tggtcctggt tacagcagta gaggaggtta tggaggtggt ggaccaggat       540
     atggaaacca gggtggtgga tatggtggtg gaggaggagg ctatgatggt tacaatgaag       600
     gaggaaattt tggtggaggt aactatggtg gtggtggaaa ctataatgac tttggaaatt       660
     atagtggaca gcaacaatca aattatggac ccatgaaggg gggcagtttt ggtggaagaa       720
     gctcaggcag tccctatggt ggtggctatg gatctggagg tggaagtggt ggatatggta       780
     gcagaaggtt ttaaaataaa acagaaacgg ctacagttct tagcaggaga gagagcgagg       840
     agttgtcagg aaagctgcag gttactttga gacagtcgtc ccaaatgcat tagaggaact       900
     gtaaaaatct gccacagaag gaacgatgat ccatagtcag aaaagttact gcagcttaaa       960
     caggaaaccc ttcttgttca ggactgtcat agccacagtt tgcaaaaagt gcagctattg      1020
     attaatgcaa tgtagtgtca attagatgta cattcctgag gtcttttatc tgttgtagct      1080
     ttgtcttttt ctttttcttt tcattacatc aggtatattg ccctgtaaat tgtggtagtg      1140
     gtaccaggaa taaaaaatta aggaattttt aacttttcaa aaaaaaaaaa aaaaaaaaaa      1200
     aa                                                                     1202
//

If you have problems or comments...

PBIL Back to PBIL home page