(data stored in ACNUC1829 zone)

EMBL: BC092652

ID   BC092652; SV 1; linear; mRNA; STD; ROD; 3809 BP.
XX
AC   BC092652;
XX
DT   06-APR-2005 (Rel. 83, Created)
DT   12-JUN-2008 (Rel. 96, Last updated, Version 7)
XX
DE   Rattus norvegicus tetraspanin 11, mRNA (cDNA clone MGC:109445
DE   IMAGE:7320221), complete cds.
XX
KW   MGC.
XX
OS   Rattus norvegicus (Norway rat)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Rattus.
XX
RN   [1]
RP   1-3809
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-3809
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (04-APR-2005) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; 04545498456e876c3a53bd6d4a3ba5b3.
DR   Ensembl-Gn; ENSRNOG00000054360; rattus_norvegicus.
DR   Ensembl-Tr; ENSRNOT00000087834; rattus_norvegicus.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Drs. Josef Lazar  & Howard Jacob, Medical
CC   College of Wisconsin
CC   cDNA Library Preparation: Express Genomics
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: Sequencing Group at the Stanford Human Genome
CC   Center, Stanford University School of Medicine, Stanford, CA  94305
CC   Web site:       http://www-shgc.stanford.edu
CC   Contact:  (Dickson, Mark) mcd@paxil.stanford.edu
CC   Dickson, M., Schmutz, J., Grimwood, J., Rodriquez, A., and Myers,
CC   R. M.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAK Plate: 214 Row: o Column: 18
CC   This clone was selected for full length sequencing because it
CC   passed the following selection criteria: matched mRNA gi: 66730383.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3809
FT                   /organism="Rattus norvegicus"
FT                   /lab_host="DH10B"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NIH_MGC_255"
FT                   /clone="MGC:109445 IMAGE:7320221"
FT                   /tissue_type="Brain, rat"
FT                   /note="Vector: pExpress1"
FT                   /db_xref="taxon:10116"
FT   gene            1..3809
FT                   /gene="Tspan11"
FT                   /note="synonym: RGD1305424"
FT   CDS_pept        135..896
FT                   /codon_start=1
FT                   /gene="Tspan11"
FT                   /product="tetraspanin 11"
FT                   /db_xref="GOA:Q568Y5"
FT                   /db_xref="InterPro:IPR000301"
FT                   /db_xref="InterPro:IPR008952"
FT                   /db_xref="InterPro:IPR018499"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q568Y5"
FT                   /protein_id="AAH92652.1"
FT                   /translation="MAHCKTEQDDWLLAHLKYLLFIFNFFFWVGGAAVMAVGIWTLVEK
FT                   SVYLSILASSTFAASAYVLIFVGGLVMTTGFLGFGAIIREQKSCLSTYFCLLLAIFLVE
FT                   LVAGVLAHVYYQRLSDELKRHLHSTLTEHYGQPGAAEITASVDRLQQDFKCCGSNSSAD
FT                   WQHSVYILSQEAIGRQVPDSCCKTVVARCGQRAHPSNIYKVEGGCMAKLEQFLADHLLL
FT                   MGAVGIGVACLQICGMVLTCCLHRRLQQHFY"
XX
SQ   Sequence 3809 BP; 863 A; 1074 C; 1050 G; 822 T; 0 other;
     ggcagccggc cacggccacc gcgggccagt gggcagggag cgggctgctg tggccaggac        60
     aaccacaatc actgctctgg actccggatc cctggctgca tccagcctgg cggttgtggc       120
     ccggcccagc tgccatggcg cactgcaaga cagagcagga tgactggctg ctggcccacc       180
     tgaagtacct gctttttatc ttcaacttct tcttctgggt aggtggggca gctgtcatgg       240
     ccgtgggtat ctggacactg gtggagaaga gtgtttacct cagcatcttg gcctccagca       300
     cgtttgctgc ctctgcctac gtcctcattt tcgttggcgg tcttgtcatg acaactggct       360
     tcctgggctt cggggccatc atccgggagc agaagagctg tctctccaca tatttctgcc       420
     tgttgctggc catcttcctg gtggagctgg tggcaggggt cctggcgcat gtgtactacc       480
     agaggctaag cgatgaactg aagcggcatc tgcacagcac cctgactgag cactatgggc       540
     agcccggagc cgcagagatc acagcctcag tggaccgtct gcagcaggat ttcaaatgtt       600
     gtggcagtaa cagctcagcc gactggcagc acagcgtata catcttgtct caggaagcca       660
     tcggtcgcca agtgcccgac agctgctgca agacagtggt agcccgctgt ggtcagcggg       720
     cccacccctc caacatctac aaggtagagg gaggctgcat ggccaagctg gagcagttct       780
     tggctgacca cctgctgctc atgggagcag tgggcattgg ggtagcctgt cttcagatct       840
     gcggaatggt tctcacctgc tgcttgcacc gaaggctcca gcagcacttt tattaaagga       900
     tacccctgta gcctgctgac tggcccacac caaagcccac atctccacat cctgaaccag       960
     gcctgcaaag tcaatgctgg ggccatggac tccctccacc ctgtgcagag gccaccaaat      1020
     gccggtgatt gtgactcctg tgtatcctgg ctgggcaggg tcctccgctc actcctccac      1080
     ttctaagcac ttagccactg ccagaatcct tggcaaggga tggtcctggc aagagacaga      1140
     cacagccctt tgccaggcac tgggacactg gactacgggg aggccatatt catctcagag      1200
     tctggaatag aagatgtccc tccaagactc ctgcagggct tggtgtgcgc ttctcatggg      1260
     cacggggccc caactgggtc tcctcagaga aaagcagcac tttgggcaca ctgggttagc      1320
     tcaccccttc ccaaaatcta gctggttttt cagtgtcccc cacagaatag ccagccatat      1380
     tcttcctgta aggcacgggg caggagccat ctaaggtggc atcttaaggc tgttgacgcc      1440
     accaggacag ggcactaagg aggcaggttg gttgctacac tcaggagaga gtcacaggat      1500
     ggccacaagc cccagcctct ggtcctggtc ccaggcttga ctcccaaagt gtaaaactct      1560
     tccccagggg ggcataccac agtctcagct cctgaggaga ggaaactgtg gggaaggagg      1620
     taccctgcct gtaccccatt tcctggggac cccactgttt ctcttccatg cgttctccac      1680
     ttccttctcc gctatcctgg aatagacgcc atcatcccct cctttgttcc cctctctagt      1740
     catggaatga cacacagagg atatttcagg ggaggggggc tcatgtgtta aaagacacag      1800
     aaagaaaatc ctagaaaaat taaaggttgg taataggaat caactcatag acaaccatag      1860
     ggaccccctc cgattactat tactgtaggc agctttgcac gccaggactc cactcccagc      1920
     ttctgcaccc ctatcctggg tcctgctcat ctctccagaa cagcagatct cagttcccac      1980
     agatcctgct gagctgggtc agttgctgga gggagatgag ctcccactca tacttgggtg      2040
     gaccaagggc cactgttgct gtcaccggca taggtgggat tccactctca gggcagaaag      2100
     tagctgtgtg gacagaggga gcatcaggct ctcgggtcag aaaccctccc ccactctggc      2160
     atctcggggg gctacttgga gcctgcactg gcttgtgtca tccacctgaa ggagcctggg      2220
     ttgtctgtac agacagtaaa aagaagacat tcccaacact tccagactac actatggcta      2280
     agagaaaaac cttaactgcc ctcctctcca tctgcagata ctcagaggct ggctatggtt      2340
     cctgagttta tagagggagg attgaggaga aaaagctgtg gggctcagac cctcttcttc      2400
     ccaaaaaggc ccctgagggg ggcaatagtg atcaaaggga tactgtggcc tcgggtatct      2460
     gctttggtag gcttcttcag ggagagggtc agaggtgaca agcgggcgcc atttgtacag      2520
     acttgaggca gaggtagttc aggagagcag ggacatggcc acagtcagag ctgcagggtg      2580
     agcggacagc cccaaatgtg acttccttga tcatacatca gccttggtga caagatgggg      2640
     tcagaggaca tgagacacat agtaggccag attctgtcca gcagctgcgg agagaaggct      2700
     gcagccaagt ctgtggtgag gtgggcccat cagaggccag aacaggtgct gcgtgtgggg      2760
     ggacgtacag aaggtcagag cgaggagcca ctgtgagctc agaatctgcc cctctgggca      2820
     gcttccaagg ttttgaagtc agggggataa tggatcagtt acaaccctgt cagctttgaa      2880
     aacaccccct tgcccattgg ctttactggg ctaggggcaa aaaggaaaaa gaagcgaggg      2940
     tggctgtagc tgtttaggag gagagcagct ggctgtgtgg ctgccaggtg gctcttatgc      3000
     cctccctggc cactgcaatg tgtcagcacc tcccgaggac tcttcaggac agaatactgc      3060
     ctccccagag tggctctaag gaagccggag cctccaggtg accttcctgc taagttccca      3120
     gatagcggtg atgggcatcc acaccgcgcc acaggatgga ccacgtgagg gcaccacccc      3180
     ctcccttcat atgtcagagc ccccaagtgc ccaaaggcac gcaggccatc tggcctgtgt      3240
     cacacatgga gcaactagag actgtttcca ctgggtccac agagagggtg ggatgaagcc      3300
     agccaccgag tggtttacaa aaccagccac gtacgtgcct ctcaacagtg tgcgctcgac      3360
     acacccgccc tactgatcta cgacttggtc agtaggtcag atggaagggg attccgtgta      3420
     ctcccagatc acgccctttt ctctatgcct tggggtggct ctgctgcccc ctggtcactc      3480
     tagcatgtcc agctggacat caagcctccc tcatcctccc ctcctgctca tgtacctgtg      3540
     aaacctgctc gtatcccgtg ccagtactga cagaaatccc agtgggccca tcgttaggaa      3600
     gccagatggg ctcctgggtc cagttggccc aggcatgtga attatcagac attctacaaa      3660
     gacagacgtt gccttaccct accgcttaca gtgaaactcc tatgtgggtt gtgcctctcc      3720
     actggtcagt gtatgcttgg tgccttgtct ctatgaactc aataataaag gactttacca      3780
     cggaaaaaaa aaaaaaaaaa aaaaaaaaa                                        3809
//

If you have problems or comments...

PBIL Back to PBIL home page