(data stored in ACNUC1829 zone)

EMBL: BC093031

ID   BC093031; SV 1; linear; mRNA; STD; HUM; 1391 BP.
XX
AC   BC093031;
XX
DT   06-APR-2005 (Rel. 83, Created)
DT   15-OCT-2008 (Rel. 97, Last updated, Version 8)
XX
DE   Homo sapiens tetraspanin 4, mRNA (cDNA clone MGC:110935 IMAGE:30334510),
DE   complete cds.
XX
KW   MGC.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1391
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-1391
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (04-APR-2005) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; 1f2e81809f3c75e58d2e4e21184c7690.
DR   Ensembl-Gn; ENSG00000214063; homo_sapiens.
DR   Ensembl-Tr; ENST00000397397; homo_sapiens.
DR   Ensembl-Tr; ENST00000397404; homo_sapiens.
DR   Ensembl-Tr; ENST00000397406; homo_sapiens.
DR   Ensembl-Tr; ENST00000397408; homo_sapiens.
DR   Ensembl-Tr; ENST00000397411; homo_sapiens.
DR   Ensembl-Tr; ENST00000409543; homo_sapiens.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Dr. Stefan Hansson
CC   cDNA Library Preparation: Michael Brownstein /  Ted Usdin
CC   Laboratory
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: Sequencing Group at the Stanford Human Genome
CC   Center, Stanford University School of Medicine, Stanford, CA  94305
CC   Web site:       http://www-shgc.stanford.edu
CC   Contact:  (Dickson, Mark) mcd@paxil.stanford.edu
CC   Dickson, M., Schmutz, J., Grimwood, J., Rodriquez, A., and Myers,
CC   R. M.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAK Plate: 198 Row: g Column: 7
CC   This clone was selected for full length sequencing because it
CC   passed the following selection criteria: matched mRNA gi: 68799996.
CC   Differences found between this sequence and the human reference
CC   genome (build 36) are described in misc_difference features below.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1391
FT                   /organism="Homo sapiens"
FT                   /lab_host="DH10B"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NIH_MGC_148"
FT                   /clone="MGC:110935 IMAGE:30334510"
FT                   /tissue_type="Placenta, pre-eclamptic"
FT                   /note="Vector: pBluescriptR"
FT                   /db_xref="taxon:9606"
FT   gene            1..1391
FT                   /gene="TSPAN4"
FT                   /note="synonyms: TETRASPAN, TSPAN-4, NAG-2, NAG2"
FT   CDS_pept        179..895
FT                   /codon_start=1
FT                   /gene="TSPAN4"
FT                   /product="tetraspanin 4"
FT                   /db_xref="GOA:O14817"
FT                   /db_xref="H-InvDB:HIT000334522.9"
FT                   /db_xref="HGNC:HGNC:11859"
FT                   /db_xref="InterPro:IPR000301"
FT                   /db_xref="InterPro:IPR008952"
FT                   /db_xref="InterPro:IPR018499"
FT                   /db_xref="InterPro:IPR018503"
FT                   /db_xref="UniProtKB/Swiss-Prot:O14817"
FT                   /protein_id="AAH93031.1"
FT                   /translation="MARACLQAVKYLMFAFNLLFWLGGCGVLGVGIWLAATQGSFATLS
FT                   SSFPSLSAANLLIITGAFVMAIGFVGCLGAIKENKCLLLTFFLLLLLVFLLEATIAILF
FT                   FAYTDKIDRYAQQDLKKGLHLYGTQGNVGLTNAWSIIQTDFRCCGVSNYTDWFEVYNAT
FT                   RVPDSCCLEFSESCGLHAPGTWWKAPCYETVKVWLQENLLAVGIFGLCTALVQILGLTF
FT                   AMTMYCQVVKADTYCA"
FT   misc_difference 344
FT                   /gene="TSPAN4"
FT                   /note="'C' in cDNA is 'T' in the human genome; no amino
FT                   acid change."
FT   misc_difference 1369
FT                   /gene="TSPAN4"
FT                   /note="'G' in cDNA is 'A' in the human genome."
FT   misc_difference 1375..1391
FT                   /gene="TSPAN4"
FT                   /note="polyA tail: 17 bases do not align to the human
FT                   genome."
XX
SQ   Sequence 1391 BP; 233 A; 443 C; 434 G; 281 T; 0 other;
     gagtaacggt ggcctggggt cagagccagg ttcagctgcg aggctgctgg tggctgtgga        60
     gagcttgggg cttccttggt cgcacccacc acctgcctgc ccactggtca gccttcaggg       120
     accctgagca ccgcctggtc tctttcctgt ggccagccca gaactgaagc gctgcggcat       180
     ggcgcgcgcc tgcctccagg ccgtcaagta cctcatgttc gccttcaacc tgctcttctg       240
     gctgggaggc tgtggcgtgc tgggtgtcgg catctggctg gccgccacac aggggagctt       300
     cgccacgctg tcctcttcct tcccgtccct gtcggctgcc aacctgctca tcatcaccgg       360
     cgcctttgtc atggccatcg gcttcgtggg ctgcctgggt gccatcaagg agaacaagtg       420
     cctcctgctc actttcttcc tgctgctgct gctggtgttc ctgctggagg ccaccatcgc       480
     catcctcttc ttcgcctaca cggacaagat tgacaggtat gcccagcaag acctgaagaa       540
     aggcttgcac ctgtacggca cgcagggcaa cgtgggcctc accaacgcct ggagcatcat       600
     ccagaccgac ttccgctgct gtggcgtctc caactacact gactggttcg aggtgtacaa       660
     cgccacgcgg gtacctgact cctgctgctt ggagttcagt gagagctgtg ggctgcacgc       720
     ccccggcacc tggtggaagg cgccgtgcta cgagacggtg aaggtgtggc ttcaggagaa       780
     cctgctggct gtgggcatct ttgggctgtg cacggcgctg gtgcagatcc tgggcctgac       840
     cttcgccatg accatgtact gccaagtggt caaggcagac acctactgcg cgtaggccgc       900
     ccaccgcccg cttctctgcc aaaaggacgc ccacggggag atggccgcac ccacagctgc       960
     ctttcccacc accagcctcg gtgctctgcc ccatgctggg aggagggagg gagggacagg      1020
     tgcctggagc ccccggaacc ctgtttctgg aaggccctag ctcaggtggc ttcagggcct      1080
     ccggaccccc cctgggaggg gtggccacgt gctggctgcg gaacccaggg caggggtggg      1140
     aggggcctcc agcacttttt atatttacgt attctccaaa gcagtgttca cacgggagcc      1200
     agcctgtggc ccccagcctc ctggaaaaca ggttggcgct ggaggagccg ggtcttggca      1260
     tcctggaggt ggccccactg gtcctggtgc tccaggcggg gccgtggacc cctcacctac      1320
     attccatagt gggcccgtgg ggctcctggt gcatcttaat aaagtgtggg cagcgaaaaa      1380
     aaaaaaaaaa a                                                           1391
//

If you have problems or comments...

PBIL Back to PBIL home page