(data stored in ACNUC23390 zone)

EMBL: BC093243

ID   BC093243; SV 1; linear; mRNA; STD; VRT; 1486 BP.
XX
AC   BC093243;
XX
DT   06-APR-2005 (Rel. 83, Created)
DT   21-OCT-2008 (Rel. 97, Last updated, Version 5)
XX
DE   Danio rerio motor neuron and pancreas homeobox 1, mRNA (cDNA clone
DE   MGC:112174 IMAGE:7431448), complete cds.
XX
KW   MGC.
XX
OS   Danio rerio (zebrafish)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
OC   Actinopterygii; Neopterygii; Teleostei; Ostariophysi; Cypriniformes;
OC   Cyprinidae; Danio.
XX
RN   [1]
RP   1-1486
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-1486
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (04-APR-2005) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; d1a376ece0486bcab5ec1a5d8559f058.
DR   Ensembl-Gn; ENSDARG00000035984; danio_rerio.
DR   Ensembl-Tr; ENSDART00000052236; danio_rerio.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: William S. Talbot, Stanford University
CC   cDNA Library Preparation: Dr. Sumio Sugano
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: Sequencing Group at the Stanford Human Genome
CC   Center, Stanford University School of Medicine, Stanford, CA  94305
CC   Web site:       http://www-shgc.stanford.edu
CC   Contact:  (Dickson, Mark) mcd@paxil.stanford.edu
CC   Dickson, M., Schmutz, J., Grimwood, J., Rodriquez, A., and Myers,
CC   R. M.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAK Plate: 226 Row: g Column: 5
CC   This clone was selected for full length sequencing because it
CC   passed the following selection criteria: matched mRNA gi: 62751557.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1486
FT                   /organism="Danio rerio"
FT                   /lab_host="DH10B"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NIH_ZGC_19"
FT                   /clone="MGC:112174 IMAGE:7431448"
FT                   /tissue_type="Larvae, whole, 5 day old, mixed wild type,
FT                   650 pooled"
FT                   /note="Vector: pME18S-FL3"
FT                   /db_xref="taxon:7955"
FT   gene            1..1486
FT                   /gene="mnx1"
FT                   /note="synonyms: zgc:112174, hlxb9"
FT   CDS_pept        133..1068
FT                   /codon_start=1
FT                   /gene="mnx1"
FT                   /product="motor neuron and pancreas homeobox 1"
FT                   /db_xref="GOA:Q6SYZ1"
FT                   /db_xref="InterPro:IPR001356"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR017970"
FT                   /db_xref="InterPro:IPR020479"
FT                   /db_xref="UniProtKB/TrEMBL:Q6SYZ1"
FT                   /db_xref="ZFIN:ZDB-GENE-040409-1"
FT                   /protein_id="AAH93243.1"
FT                   /translation="MEKSKNFRIDALLAVDPPKVQTSPLALVTSLPTSSISSSSDSVQA
FT                   VELTTNSDALQTESPSPPRISSCGLIPKPGFLNSPHSGMVGLHPQSSTGIPPQALYGHP
FT                   MYTYSAAALGQHPALSYSYPHGSHHHHHPSDPLKLTASSFQLDHWLRVSTAGMMLPKMA
FT                   DFNGQAQSNLLGKCRRPRTAFTSQQLLELEHQFKLNKYLSRPKRFEVATSLMLTETQVK
FT                   IWFQNRRMKWKRSKKAKEQAAQDAEKQKGKGNHDKMDGLEKDYQKVDSGKSNRIRDFRD
FT                   SDDEEGDNYMLNSSDCSSEDERTNDISPQP"
XX
SQ   Sequence 1486 BP; 461 A; 359 C; 319 G; 347 T; 0 other;
     agcagttgac aagtggactt ctggcttgca caccttggcc aagatcataa ctttacgaag        60
     aggagcggtg acactcctga cagcctttta aagttacgaa cgaggcgtta atctgtttgt       120
     gaggtgggcc agatggagaa atctaaaaac tttcggatcg acgcgcttct ggctgtcgat       180
     ccaccaaaag tgcagacctc gccgctggcg ctggtcacct ccctgcccac ctcatccata       240
     tcctcctctt ccgacagcgt ccaggcggtg gagctgacca cgaactccga cgcactccag       300
     acagagtctc catcgccacc caggatatcg tcttgcggct tgattcccaa accgggtttc       360
     ctgaactctc cacattcggg catggtcgga ctacaccctc agagcagtac cgggattcct       420
     cctcaggctc tctacggtca cccaatgtac acgtattcag cagcagcgct cggtcagcac       480
     ccggcgctct cgtactcata cccgcacggt tcccaccatc atcaccatcc cagcgacccc       540
     ctcaaactca cagccagctc ctttcagctc gaccactggc tgagggtctc caccgccgga       600
     atgatgctgc ctaaaatggc agatttcaat ggccaggcgc agtcgaactt actcggcaag       660
     tgcagaagac caagaactgc attcacaagc cagcagctcc ttgaacttga gcatcagttt       720
     aagctgaata aatatctatc cagaccaaaa cgctttgaag tggccacgtc attgatgcta       780
     acagagacgc aggtgaaaat ctggtttcag aacaggcgca tgaaatggaa gcgcagtaaa       840
     aaggccaaag aacaagccgc tcaagatgcc gagaagcaaa agggaaaagg aaaccacgac       900
     aaaatggacg gactggaaaa ggactaccag aaggtagatt cagggaaaag taacagaata       960
     cgggacttta gggacagtga cgacgaagaa ggagataact atatgctgaa ttcatctgat      1020
     tgttcctctg aggatgaacg aaccaatgac ataagtccac aaccatgaga ccttataaaa      1080
     acgaaagact atgagtgaat tatgtgattt gtatgtatca tcatcttgca gtcaatatgg      1140
     aaatgcagag gtgacatcca catgagctgt ttgtacacat acaaacataa atactattcc      1200
     tgaagagcat gtggtaatca catcaggtaa aatagatgag taaaggccta tcaataatta      1260
     acatcattaa gatgtcccca tatccatgac cactgcgtgt ttatttctga attgaaatag      1320
     gatgaaaata ggcatttcat actagaatca tacgtgatct gtttattttt atacaatgta      1380
     tttataacta aatcgctttt aaaatgcatg taaattattg ttcatgttta tcagttgtac      1440
     gctctgtgaa taaagttaca tttttgtaaa aaaaaaaaaa aaaaaa                     1486
//

If you have problems or comments...

PBIL Back to PBIL home page