(data stored in ACNUC23390 zone)

EMBL: BC093243

ID   BC093243; SV 1; linear; mRNA; STD; VRT; 1486 BP.
XX
AC   BC093243;
XX
DT   06-APR-2005 (Rel. 83, Created)
DT   21-OCT-2008 (Rel. 97, Last updated, Version 5)
XX
DE   Danio rerio motor neuron and pancreas homeobox 1, mRNA (cDNA clone
DE   MGC:112174 IMAGE:7431448), complete cds.
XX
KW   MGC.
XX
OS   Danio rerio (zebrafish)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
OC   Actinopterygii; Neopterygii; Teleostei; Ostariophysi; Cypriniformes;
OC   Cyprinidae; Danio.
XX
RN   [1]
RP   1-1486
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-1486
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (04-APR-2005) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; d1a376ece0486bcab5ec1a5d8559f058.
DR   Ensembl-Gn; ENSDARG00000035984; danio_rerio.
DR   Ensembl-Tr; ENSDART00000052236; danio_rerio.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: William S. Talbot, Stanford University
CC   cDNA Library Preparation: Dr. Sumio Sugano
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: Sequencing Group at the Stanford Human Genome
CC   Center, Stanford University School of Medicine, Stanford, CA  94305
CC   Web site:       http://www-shgc.stanford.edu
CC   Contact:  (Dickson, Mark) mcd@paxil.stanford.edu
CC   Dickson, M., Schmutz, J., Grimwood, J., Rodriquez, A., and Myers,
CC   R. M.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAK Plate: 226 Row: g Column: 5
CC   This clone was selected for full length sequencing because it
CC   passed the following selection criteria: matched mRNA gi: 62751557.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1486
FT                   /organism="Danio rerio"
FT                   /lab_host="DH10B"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NIH_ZGC_19"
FT                   /clone="MGC:112174 IMAGE:7431448"
FT                   /tissue_type="Larvae, whole, 5 day old, mixed wild type,
FT                   650 pooled"
FT                   /note="Vector: pME18S-FL3"
FT                   /db_xref="taxon:7955"
FT   gene            1..1486
FT                   /gene="mnx1"
FT                   /note="synonyms: zgc:112174, hlxb9"
FT   CDS_pept        133..1068
FT                   /codon_start=1
FT                   /gene="mnx1"
FT                   /product="motor neuron and pancreas homeobox 1"
FT                   /db_xref="GOA:Q6SYZ1"
FT                   /db_xref="InterPro:IPR001356"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR017970"
FT                   /db_xref="InterPro:IPR020479"
FT                   /db_xref="UniProtKB/TrEMBL:Q6SYZ1"
FT                   /db_xref="ZFIN:ZDB-GENE-040409-1"
FT                   /protein_id="AAH93243.1"
FT                   /translation="MEKSKNFRIDALLAVDPPKVQTSPLALVTSLPTSSISSSSDSVQA
FT                   VELTTNSDALQTESPSPPRISSCGLIPKPGFLNSPHSGMVGLHPQSSTGIPPQALYGHP
FT                   MYTYSAAALGQHPALSYSYPHGSHHHHHPSDPLKLTASSFQLDHWLRVSTAGMMLPKMA
FT                   DFNGQAQSNLLGKCRRPRTAFTSQQLLELEHQFKLNKYLSRPKRFEVATSLMLTETQVK
FT                   IWFQNRRMKWKRSKKAKEQAAQDAEKQKGKGNHDKMDGLEKDYQKVDSGKSNRIRDFRD
FT                   SDDEEGDNYMLNSSDCSSEDERTNDISPQP"
XX
SQ   Sequence 1486 BP; 461 A; 359 C; 319 G; 347 T; 0 other;
     agcagttgac aagtggactt ctggcttgca caccttggcc aagatcataa ctttacgaag        60
     aggagcggtg acactcctga cagcctttta aagttacgaa cgaggcgtta atctgtttgt       120
     gaggtgggcc agatggagaa atctaaaaac tttcggatcg acgcgcttct ggctgtcgat       180
     ccaccaaaag tgcagacctc gccgctggcg ctggtcacct ccctgcccac ctcatccata       240
     tcctcctctt ccgacagcgt ccaggcggtg gagctgacca cgaactccga cgcactccag       300
     acagagtctc catcgccacc caggatatcg tcttgcggct tgattcccaae"gcgtgttsg       .Csaiers
Fggccng sd-seacng sca ctaggaaaag 300
er;
ct cggcttgcgt ggctgt42at       tcgacaag gatgccgctg cggctt;
ct gcctttgcag acacatcgga ccgctggaac ggctgt4gat       gtcggaga ccdu
Cccac cccgaaccgc gcggccccac agaccccacc catcctcccc ggctgt54sg       0
  cctg ccactacaag tccttacaag cggtggacct tctttccers
Fgggagtsca tttacgaaag      tcttaggcg tc
   acct gaggcttaag acgcgacagt gatgagctgt  cctacataa ctttac6tsg     ccaccaccaa ataagctggt gcttaataac acacatcacc t .Csaigtg gccacagcct ggctgt72at     acaggcgaga catagatgrs
Fgg180
    cggattg    ccagtctgac agtcttagga tttacg78ag       300
aagt gagtg  aag gccgctgcag aacgacagta tg  agtggg gc
er;
caa tttacg84at     acag80
  g aacgatgcag tataaggtca gggcccataa gagg  aagg aaggtgggac ggctgt9aag        agtggct ccctgg  aa gttgaaccag aacgcgaggc catcg
     caacgaacac ctcatc9tsg      ggttgacta gtctcctgtg agtcataaaa gttcgcctga atagaggcga tcctgcttct ggctg102sg     cct40
   g    6 .Csag aacgctt;ct gtcagcacct aacgctcttc ccctac
    ggctg108ag       g
  gtga atgctgtgcingtt;
aggct ggtt;
caca cctgctactt gttaagagtg ggctg114at     acaccaccat ct;cttgccc gctcttgcgc t .taggaat  caaggggcc adu
Cttgcg ggctg120sg     cca300
ert ggcgcgactg cctcgacgcc aacgaggg   caacag80ta cctggcctac ctcat126ag       3cctggcc aggggcggca ctgcccacaa attggtgcgc t ggcttgtg agtctaacga ctcat13tgt       tg  aaga gtcggcttat  ccgaacaca ctc;
aggcg att ggctta atagctt;
c ctcat138ag     tctac
 cga catcggattt    agtccac caact ggcg tcctgatt g acagcc;
ct ctcat144at     ggagaggcga tacagcctta tccgttataa gggggggggg gggggg                          //

If you have blems rod"omsue s...0">A

PBIL0">A Back4-APPBILnd pa nege