(data stored in ACNUC9552 zone)

EMBL: BC094213

ID   BC094213; SV 1; linear; mRNA; STD; ROD; 2395 BP.
XX
AC   BC094213;
XX
DT   20-APR-2005 (Rel. 83, Created)
DT   16-JUL-2006 (Rel. 88, Last updated, Version 5)
XX
DE   Rattus norvegicus Bcl2-like 1, mRNA (cDNA clone MGC:105402 IMAGE:7314572),
DE   complete cds.
XX
KW   MGC.
XX
OS   Rattus norvegicus (Norway rat)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Rattus.
XX
RN   [1]
RP   1-2395
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-2395
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (18-APR-2005) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; f7e184627343fd515dbec43ef019dd9e.
DR   Ensembl-Gn; ENSRNOG00000007946; rattus_norvegicus.
DR   Ensembl-Tr; ENSRNOT00000010762; rattus_norvegicus.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Drs. Josef Lazar  & Howard Jacob, Medical
CC   College of Wisconsin
CC   cDNA Library Preparation: Express Genomics
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: National Institutes of Health Intramural
CC   Sequencing Center (NISC),
CC   Gaithersburg, Maryland;
CC   Web site: http://www.nisc.nih.gov/
CC   Contact: nisc_mgc@nhgri.nih.gov
CC   Akhter,N., Ayele,K., Beckstrom-Sternberg,S.M., Benjamin,B.,
CC   Blakesley,R.W., Bouffard,G.G., Breen,K., Brinkley,C., Brooks,S.,
CC   Dietrich,N.L., Granite,S., Guan,X., Gupta,J., Haghighi,P.,
CC   Hansen,N., Ho,S.-L., Karlins,E., Kwong,P., Laric,P., Legaspi,R.,
CC   Maduro,Q.L., Masiello,C., Maskeri,B., Mastrian,S.D.,McCloskey,J.C.,
CC   McDowell,J., Pearson,R., Stantripop,S., Thomas,P.J., Touchman,J.W.,
CC   Tsurgeon,C., Vogt,J.L., Walker,M.A., Wetherby,K.D., Wiggins,L.,
CC   Young,A., Zhang,L.-H. and Green,E.D.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAK Plate: 203 Row: i Column: 10
CC   This clone was selected for full length sequencing because it
CC   passed the following selection criteria: matched mRNA gi: 75992931.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2395
FT                   /organism="Rattus norvegicus"
FT                   /lab_host="DH10B"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NIH_MGC_254"
FT                   /clone="MGC:105402 IMAGE:7314572"
FT                   /tissue_type="Brain, rat"
FT                   /note="Vector: pExpress1"
FT                   /db_xref="taxon:10116"
FT   gene            1..2395
FT                   /gene="Bcl2l1"
FT                   /note="synonyms: Bclx, Bcl2l, Bcl-xl, bcl-X"
FT   CDS_pept        179..880
FT                   /codon_start=1
FT                   /gene="Bcl2l1"
FT                   /product="Bcl2-like 1"
FT                   /db_xref="GOA:P53563"
FT                   /db_xref="InterPro:IPR002475"
FT                   /db_xref="InterPro:IPR003093"
FT                   /db_xref="InterPro:IPR004725"
FT                   /db_xref="InterPro:IPR013279"
FT                   /db_xref="InterPro:IPR020717"
FT                   /db_xref="InterPro:IPR020726"
FT                   /db_xref="InterPro:IPR020728"
FT                   /db_xref="InterPro:IPR020731"
FT                   /db_xref="InterPro:IPR026298"
FT                   /db_xref="InterPro:IPR036834"
FT                   /db_xref="PDB:1AF3"
FT                   /db_xref="PDB:4QNQ"
FT                   /db_xref="UniProtKB/Swiss-Prot:P53563"
FT                   /protein_id="AAH94213.1"
FT                   /translation="MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEETEPER
FT                   ETPSAINGNPSWHLADSPAVNGATGHSSSLDAREVIPMAAVKQALREAGDEFELRYRRA
FT                   FSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQVLV
FT                   SRIASWMATYLNDHLEPWIQENGGWDTFVDLYGNNAAAESRKGQERFNRWFLTGMTVAG
FT                   VVLLGSLFSRK"
XX
SQ   Sequence 2395 BP; 517 A; 685 C; 654 G; 539 T; 0 other;
     ccccggtctc ttcaggggaa actgaggccg gcttctccgg gagattcggc acgagcagtc        60
     agccagaacc ctatcttggc tttggatcct ggaagagaat cgctaaacac agagcagacc       120
     cagtgagtga gcaggtgttt tggacaatgg actggttgag cccatctcta ttataaaaat       180
     gtctcagagc aaccgggagc tggtggttga ctttctctcc tacaagctct cccagaaagg       240
     atacagctgg agtcagttta gcgatgtcga agagaacagg actgaagccc cagaagaaac       300
     tgaaccagaa agggagaccc ccagtgccat caatggcaac ccatcctggc acctggcgga       360
     tagccccgcg gtgaatggag ccactggcca cagcagcagt ttggatgcgc gggaggtaat       420
     ccccatggca gcagtgaagc aagcgctgag agaggctggc gatgagtttg aactgcggta       480
     ccggagagca ttcagtgatc taacatccca gcttcatata accccaggga cagcatatca       540
     gagctttgaa caggtagtga atgaactctt tcgggatggg gtaaactggg gtcgcattgt       600
     ggccttcttc tcctttggcg gggcactgtg cgtggaaagc gtagacaagg agatgcaggt       660
     attggtgagt cggattgcaa gttggatggc cacctacctg aatgaccacc tagagccttg       720
     gatccaggag aacggcggct gggacacttt tgtggatctc tacgggaaca atgcagcagc       780
     cgagagccgg aaaggccagg agcgtttcaa ccgctggttc ctgacgggca tgactgtggc       840
     tggtgtagtt ctgctgggct cactcttcag tcggaagtga ccagacactg accgtccact       900
     cacctctcac ctcccacctt gcccccacca caactctctc ttcagccacc attgctacca       960
     ggagaaccac tacatgcaac tcacgcccct tcccctatta tagggttggg cctagacgga      1020
     gtcccctgca gttagctttc tagaatctac cacgcttctg tgaaagccac cttcccccca      1080
     catctcagtt cccttggcct caaaactcac aaggtttttc ctcagatcag ctccttggag      1140
     gctggcagga gtgggaaggg gtgtgctaga gggagaagag cctgccttgt tggtgggacc      1200
     ctgattaccc ctgagcctct cgggaatgct tttctggcag ggagctggag agctctctaa      1260
     acctcttccc ccagagacta gattgccttg gttttgatgt gtgtggcctc agaattgatc      1320
     atttcccatt ctgctgtgtc cctggggcgg ctcctccttc ccatctccac cccccccccc      1380
     cccagagcca ttgagtgagg tgcttttagc ccttttgact aactaaaaat gcaggctgct      1440
     tgggataacg aggcaaggac ctcctcccca cctgtggcct ggccaagccc ccactcctgg      1500
     tctgaatgtt ctcctgaggc ctctggctag agtccagccc cacccaggag gagggacgga      1560
     gctgcggaaa gtccaccctg cgagagcctg agcggctctt gcggcttagc accaccccag      1620
     atccttctcc acccctcccc tggctccatg gtgaccatga ctgagggacc aactgggccc      1680
     acgctaggtg ccccagagct gttaatgact tcagctgcct cacttcctgc aagatcagcc      1740
     tgtggcatct ttgccttggg tgctggccac agggtccagg gactctggcc ttagcccaga      1800
     agtgagagga agcttacagc gcagctatgg gagccctggg ggcttcccta cctcaggcag      1860
     gaagggcagg aagaagagcc tggtgcacag gtgaggagga ctgcaagggc ctgtctgtgc      1920
     cctgtcccca cctgtctgca gcagggctgc caaggtcaga atgccctggc caggagccct      1980
     tcaggcctct cctctgctcc acccttggcc tgtctcatcc ctgtgggtcc cagctcagct      2040
     ctggccaccc cgggctctct gctgtacata tctgagacta gtttttattc cttgtgaaga      2100
     tgatatacta tttttgttaa gcgtgtctgt atttatgtat gaggagctgc tggcttgctg      2160
     tgcgcgtgcc cgtggagagc tggtgcccag agactgacag cctgacgctc cctccctgcc      2220
     ctgcctgggg aagcccactg agggtcgtgg cttctgagag gcacctgtcc ctctcctccc      2280
     ctcaccctac actttttcca gctctttgaa atagtttgtg tgaaggtgaa agtgcagttc      2340
     agtaataaat ggtgtctgtg actctgtgaa aaaaaaaaaa aaaaaaaaaa aaagg           2395
//

If you have problems or comments...

PBIL Back to PBIL home page