(data stored in ACNUC8465 zone)

EMBL: BC095345

ID   BC095345; SV 1; linear; mRNA; STD; VRT; 1172 BP.
XX
AC   BC095345;
XX
DT   10-MAY-2005 (Rel. 83, Created)
DT   16-JUL-2006 (Rel. 88, Last updated, Version 4)
XX
DE   Danio rerio zgc:110639, mRNA (cDNA clone MGC:110639 IMAGE:7164577),
DE   complete cds.
XX
KW   MGC.
XX
OS   Danio rerio (zebrafish)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
OC   Actinopterygii; Neopterygii; Teleostei; Ostariophysi; Cypriniformes;
OC   Cyprinidae; Danio.
XX
RN   [1]
RP   1-1172
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-1172
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (06-MAY-2005) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; ccf1101e57869e3f421b29546029ddf2.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Genome Institute of Singapore
CC   cDNA Library Preparation: S. Mathavan, Chia-Lin Wei, and Yijun
CC   Ruan, Genome Institute of Singapore
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: Sequencing Group at the Stanford Human Genome
CC   Center, Stanford University School of Medicine, Stanford, CA  94305
CC   Web site:       http://www-shgc.stanford.edu
CC   Contact:  (Dickson, Mark) mcd@paxil.stanford.edu
CC   Dickson, M., Schmutz, J., Grimwood, J., Rodriquez, A., and Myers,
CC   R. M.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAL Plate: 67 Row: i Column: 4
CC   This clone was selected for full length sequencing because it
CC   passed the following selection criteria: matched mRNA gi: 63101240.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1172
FT                   /organism="Danio rerio"
FT                   /lab_host="DH10B"
FT                   /strain="Singapore local strain"
FT                   /mol_type="mRNA"
FT                   /clone_lib="GISZF001_ra"
FT                   /clone="MGC:110639 IMAGE:7164577"
FT                   /tissue_type="Embryo, 7 different stages (from just
FT                   fertilized embryos to 72 hours just hatched baby fish)"
FT                   /note="Vector: pDNR-LIB"
FT                   /db_xref="taxon:7955"
FT   gene            1..1172
FT                   /gene="zgc:110639"
FT                   /note="synonym: MGC110639"
FT   CDS_pept        65..709
FT                   /codon_start=1
FT                   /gene="zgc:110639"
FT                   /product="zgc:110639"
FT                   /db_xref="GOA:Q503F9"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:Q503F9"
FT                   /db_xref="ZFIN:ZDB-GENE-050522-36"
FT                   /protein_id="AAH95345.1"
FT                   /translation="MDGLLLDTERLYTVSFQEVCDRFNKQYTWEVKSSVMGKKALDAAR
FT                   IIRDKIGLPMTPEELLEETRKIQERLFPTTSLLPGVEKLVNHLHKHGIPIAVGTSSAGL
FT                   TFEMKTSRHKEFFSLFSHIVLGDDPDVKNGKPLPDTFLVCAKRFSPPANPEQCLVFEDA
FT                   PNGVKAGLAAGMQVVMIPDDNLDRSLTQEATLLLRSMEDFRPELFGLPAYA"
XX
SQ   Sequence 1172 BP; 346 A; 257 C; 235 G; 334 T; 0 other;
     acagtcgagc tatcgtatcg ccaaaaacat gtcttataaa ccagtaacac acgtgctctt        60
     tgatatggac gggttgttac tagatacaga aagattgtac acagtctcgt tccaggaagt       120
     ttgtgacagg tttaataagc agtatacttg ggaagtgaag tcctctgtta tgggcaaaaa       180
     ggctctggat gctgccagga ttataagaga caaaattggc cttcccatga cccctgaaga       240
     gctcctagaa gagaccagaa aaattcagga gcgtttgttc cccacaactt ctctgctacc       300
     aggtgtagaa aagcttgtca atcacctaca caagcatggc atccctattg ctgttggcac       360
     aagctcagca ggtctgacct ttgagatgaa gaccagccgt cataaagagt tctttagcct       420
     cttcagtcac attgtgcttg gagatgatcc ggacgtaaaa aatggcaagc cactccctga       480
     tacttttttg gtgtgtgcca aaagattctc tcccccagcc aaccctgaac agtgtttggt       540
     ttttgaagat gctccaaacg gggtgaaggc gggtctagca gctggcatgc aggtggtgat       600
     gatccctgat gataacctgg accgcagcct cacccaggaa gccaccttac tgcttagaag       660
     catggaagac ttcagaccag aactctttgg tctcccagcc tacgcgtaag gacagcaatc       720
     accacagtga tttcaattcc acttcgcttt atcctgtcaa tttttgaaaa atggaatcag       780
     gctgcagtgt agctcctgca atcaaaaaca ggagaaacta atctctacta ttatttctgt       840
     cagccatgga tttgctgttc agggacacaa cggaatgctg attgtttcaa ttattttttt       900
     attttttttt ggccaatcac aacactgaat ctctttcctt cgaccacccg gatgacacaa       960
     gacaaatttg attatgctgc tcaattagct tcagtgaaac cattaggatt tattgacatt      1020
     ttgcgtttta gctaattact gtgtgacatt ttttatctat atactttttt tttcagatct      1080
     agtgcaagtg gctcaagctg taatgtttgc atcactttaa ataaatttcc aattcagagc      1140
     tcacaaaaaa aaaaaaaaaa aaaaaaaaaa aa                                    1172
//

If you have problems or comments...

PBIL Back to PBIL home page