(data stored in ACNUC13479 zone)

EMBL: BC095560

ID   BC095560; SV 1; linear; mRNA; STD; VRT; 1119 BP.
XX
AC   BC095560;
XX
DT   10-MAY-2005 (Rel. 83, Created)
DT   21-OCT-2008 (Rel. 97, Last updated, Version 3)
XX
DE   Danio rerio zgc:92746, mRNA (cDNA clone MGC:111820 IMAGE:7293672), complete
DE   cds.
XX
KW   MGC.
XX
OS   Danio rerio (zebrafish)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
OC   Actinopterygii; Neopterygii; Teleostei; Ostariophysi; Cypriniformes;
OC   Cyprinidae; Danio.
XX
RN   [1]
RP   1-1119
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-1119
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (06-MAY-2005) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; 48581b05501c24c0e4f6ef34b23bad2b.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Pamela C. Yelick, Ph.D.
CC   cDNA Library Preparation: Dr. Sumio Sugano
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: Sequencing Group at the Stanford Human Genome
CC   Center, Stanford University School of Medicine, Stanford, CA  94305
CC   Web site:       http://www-shgc.stanford.edu
CC   Contact:  (Dickson, Mark) mcd@paxil.stanford.edu
CC   Dickson, M., Schmutz, J., Grimwood, J., Rodriquez, A., and Myers,
CC   R. M.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAK Plate: 223 Row: p Column: 11
CC   This clone was selected for full length sequencing because it
CC   passed the following selection criteria: matched mRNA gi: 50540209.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1119
FT                   /organism="Danio rerio"
FT                   /lab_host="DH10B"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NIH_ZGC_20"
FT                   /clone="MGC:111820 IMAGE:7293672"
FT                   /tissue_type="Mixed tissue"
FT                   /note="Vector: pME18S-FL3"
FT                   /db_xref="taxon:7955"
FT   gene            1..1119
FT                   /gene="zgc:92746"
FT   CDS_pept        26..826
FT                   /codon_start=1
FT                   /gene="zgc:92746"
FT                   /product="zgc:92746 protein"
FT                   /db_xref="GOA:Q502T9"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR019009"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q502T9"
FT                   /db_xref="ZFIN:ZDB-GENE-040718-311"
FT                   /protein_id="AAH95560.1"
FT                   /translation="MEERVDLDLEDFSSEPFLETFLKEIQNEDAVFLVGIFVALALVIL
FT                   TIVFFGNFWGSSKVRNAVLLLGLCDSGKTLLFTRLLLGKFVRTQTSITESSATYKSKSE
FT                   RGSSWTLIDVPGHESLRTQIVEKYKDVARAIVFVVDSSTFQKDVRDVAEFLYSILTDSI
FT                   LAKNAPTLVVACNKQDITMAKSAKLIQQQLEKELNTLRLTRSAALSSQDGAVGGSVYLG
FT                   KKGKDFEFSQLANRVEFIECKARGSKTKDGDADIDALEKCLAKL"
XX
SQ   Sequence 1119 BP; 306 A; 227 C; 279 G; 307 T; 0 other;
     tgtgtttcca tgtgtagagg aaagcatgga ggaaagggtt gatctggatt tagaggattt        60
     ctcttcagag ccgtttttgg aaacgttctt gaaagagatc cagaatgaag acgctgtttt       120
     cctcgtcggg atatttgtag cattggcgct tgtgattctc actatcgttt tctttgggaa       180
     tttttggggc tccagtaaag tgaggaatgc agtgctgttg ctgggactgt gtgactccgg       240
     gaagactctt ctgttcactc gattattact aggaaagttt gtacgaactc agacgtccat       300
     cacagagagc agtgccacat acaagagcaa aagtgagaga ggcagcagtt ggacccttat       360
     cgatgttcct ggtcatgaaa gtttaagaac tcagattgtt gagaagtaca aggatgtggc       420
     acgagccatc gtgttcgtgg tggacagcag caccttccag aaggatgtca gagatgtggc       480
     tgagtttctc tactccatcc tcacagacag catcctggcc aaaaatgccc caacactggt       540
     ggtggcctgc aacaaacaag atatcacgat ggccaaatct gccaaattaa ttcagcagca       600
     gctagagaag gagttgaaca cactgagact gacccgctcg gcagcgctct cctctcagga       660
     cggggcggtc gggggctcgg tgtacttagg gaagaaaggc aaagatttcg agttctctca       720
     gttggccaat cgggtggagt tcatcgagtg caaagccaga ggaagcaaaa ccaaggatgg       780
     agatgctgac attgatgctc tggagaagtg cctagccaaa ctctgaagat cacacagctg       840
     gagttattca gttactcaat tcaacttttc ttgttgttgt ctctggattt cactcatcat       900
     tgctgtatca gtgtacatca tgtccggata ctgtagatgc agctcacaaa tcaaactgaa       960
     tcagtgtata atgcgacccc caggcacctg tttgcttttt ccttctcact ccagggtttt      1020
     attaaagttt aagctggagt caggtcaacg tttacctttt attttatttc gctgtaaatt      1080
     atattaaaga tggattatct tgaaaaaaaa aaaaaaaaa                             1119
//

If you have problems or comments...

PBIL Back to PBIL home page