(data stored in ACNUC404 zone)

EMBL: BC096792

ID   BC096792; SV 1; linear; mRNA; STD; VRT; 2631 BP.
XX
AC   BC096792;
XX
DT   03-JUN-2005 (Rel. 84, Created)
DT   21-OCT-2008 (Rel. 97, Last updated, Version 7)
XX
DE   Danio rerio progestin and adipoQ receptor family member IIIb, mRNA (cDNA
DE   clone MGC:110079 IMAGE:7282759), complete cds.
XX
KW   MGC.
XX
OS   Danio rerio (zebrafish)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
OC   Actinopterygii; Neopterygii; Teleostei; Ostariophysi; Cypriniformes;
OC   Cyprinidae; Danio.
XX
RN   [1]
RP   1-2631
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-2631
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (01-JUN-2005) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; 7ad06456e27923e8012b1c75d6a4f944.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Cecilia Moens
CC   cDNA Library Preparation: Dr. Sumio Sugano
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: Sequencing Group at the Stanford Human Genome
CC   Center, Stanford University School of Medicine, Stanford, CA  94305
CC   Web site:       http://www-shgc.stanford.edu
CC   Contact:  (Dickson, Mark) mcd@paxil.stanford.edu
CC   Dickson, M., Schmutz, J., Grimwood, J., Rodriquez, A., and Myers,
CC   R. M.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAK Plate: 211 Row: a Column: 7
CC   This clone was selected for full length sequencing because it
CC   passed the following selection criteria: matched mRNA gi: 66911044.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2631
FT                   /organism="Danio rerio"
FT                   /lab_host="DH10B"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NIH_ZGC_18"
FT                   /clone="MGC:110079 IMAGE:7282759"
FT                   /tissue_type="Embryo, *AB wild type, 18-20 hpf, pooled from
FT                   about 1200 embryos"
FT                   /note="Vector: pME18S-FL3"
FT                   /db_xref="taxon:7955"
FT   gene            1..2631
FT                   /gene="paqr3b"
FT                   /note="synonym: zgc:110079"
FT   CDS_pept        185..1108
FT                   /codon_start=1
FT                   /gene="paqr3b"
FT                   /product="progestin and adipoQ receptor family member IIIb"
FT                   /db_xref="GOA:Q4V9P1"
FT                   /db_xref="InterPro:IPR004254"
FT                   /db_xref="UniProtKB/TrEMBL:Q4V9P1"
FT                   /db_xref="ZFIN:ZDB-GENE-050913-128"
FT                   /protein_id="AAH96792.1"
FT                   /translation="MPQNILKSTHYIELGSYQYWPVLVPRGIRLYTYEQIPMFLKENPY
FT                   ITDGYRAHLPSKLCLKSIFILSNETVNIWSHLLGFLLFFSLGVNDMATVLPSAGASRED
FT                   YVIYSIGLLCFQVCMLCSVGYHLFCCHRSEKTCRRWLALDYAGISVGILGCYVPGVFYA
FT                   FYCNSFWRQVYLLTVLALILAVFAAQIHPLYLSQQWKKLRSLMFCLVAAYGIIPACHWV
FT                   WINGGFSSEIVKVFFPRVMIMYLIAASAFLFYVSKIPERYFPGQLNYVGASHQLWHVLV
FT                   VVMFYWWHQTAVYIMNYRHNQPCGST"
XX
SQ   Sequence 2631 BP; 673 A; 584 C; 560 G; 814 T; 0 other;
     cacactctca ctttagcctt tagcttggcg gctagtcgcc gggtcatcaa catgacgccc        60
     atatgctatt attaaactga agataaggaa tataaaggac cgaatgggat aaacagcaag       120
     tgtttacctg caagtgagag gtttgctgaa actacagaga gatctaatag ccacttgaac       180
     caagatgcct caaaacatcc tgaaaagcac tcattacatt gagctgggca gctatcagta       240
     ctggccagtg cttgtgccga gaggaatccg cttgtacacc tatgaacaga ttcccatgtt       300
     tctgaaggag aatccgtaca tcacagatgg atacagagca cacctgccat caaaactgtg       360
     ccttaaaagc atattcattc tgtccaacga gacggtgaac atctggagtc atctgttggg       420
     cttcctgctg ttcttctctc tgggagtgaa tgacatggcc acagtcctgc catctgcagg       480
     ggcgtcacga gaggactacg tcatctactc aataggactc ctctgttttc aggtttgcat       540
     gctgtgctct gtgggctacc acttgttctg ttgtcatcgc tcagagaaga cctgtcgccg       600
     ctggcttgct ctggattatg ctggaatatc agtgggaatt ttgggatgtt atgtgcctgg       660
     agtcttctac gccttctact gcaacagttt ttggaggcag gtgtacctgc tgacggtgct       720
     ggctctcatc ttggctgtgt ttgcggctca gattcacccg ctctacctca gccagcagtg       780
     gaagaagctg cgctcactca tgttctgctt agtggctgca tacggcatca tcccagcctg       840
     ccactgggtc tggatcaatg gaggattttc ctcagaaatc gtaaaggtct tttttcctcg       900
     agtcatgatc atgtatttga ttgcagcctc tgcgttcctt ttttacgtca gtaaaatccc       960
     agaaagatac ttcccagggc agctgaacta tgttggtgcc agtcatcagc tgtggcacgt      1020
     gctggtggtg gtcatgttct actggtggca ccaaaccgct gtttacatca tgaactacag      1080
     acacaatcag ccttgcggca gcacttaaac atgcttatca gtccttctga gccctttagc      1140
     ttcaccatat tcacttgttt ggcattattt taaagtcggg ctgatagact cgaacaaaga      1200
     aactttacct ctcatctgcc tttgaacacc gtaccgtagg gttacgtgca attttgagct      1260
     gatctgcctg aaacgtgttt catatacagt tttttgtctg ttactttctt tgtttttgac      1320
     tcctgttgag gttttttttt ccactatggt atcaatgggc ttgtgaatcc atccattctg      1380
     ttaatatgtg gcctcatttt attggattgt ccttctgtga ctgatgaatt gtgtggaggt      1440
     tgatactgtg atactgtaac tgtgcgttca caccgaaagc ggtgagagcg tccaaggtcg      1500
     ctgtgtctgc cttcagctcc ggcagcgaga gcgtcaaaat tcgttacatt gatttcgtat      1560
     ttgaaggggc ggttgcagca tatcagttat atttctgcat aaaacatgct ttctagcatg      1620
     aaaatgttgc gcacttctta tcaaattcat ttaacaatgg aagatcgatg tggctttgct      1680
     ccacttgatt atccaatgtc tccataagtc taaaatatcg tgaagctgca accctgtttt      1740
     gtactgtcgc atgagattcc cgcttattta aagatataaa acattgattc acatcattaa      1800
     ctcgccagta acttatttaa tgtatgttcc tgtaagaaaa catcgtaaaa gattgaaaat      1860
     ccggcgaccg caataatcaa acacttggga acaactgttg tcggaaccac agttcacagg      1920
     actgtgttct ctgaagtcca ttctgattgc ttgccgctga accacgtcat agctcattac      1980
     cataaagtcg acctgatttc aactctcctc gacgcccaca acggcgaaga cgcgccgcgc      2040
     tattcctcgc aattggctct cattgaaaat gaatgacttc cagctacttt gacgctctcg      2100
     ccgccccagc tctgcacaat tttgttccaa ccctaatcag acacacctga tccaactaat      2160
     caagctgttc aagactactc ctggacacct tgattagttg gatcagctgt ggttgattag      2220
     ggttggagca aaactgtgta gagctgcggc cctccaggaa ttgactttga gacccatgct      2280
     gtaatctgtt ttaaacttgt ttggtaaagg gagccatttt gatgtattaa acacattgag      2340
     ttgatgtacg tacgcactgg aaactgggaa tttaaatgac caagaaagca ttacttcagt      2400
     actttatgtg aacaatgggt gaaaatcact atacttgcac ttgtttatta tgattatgta      2460
     ttttgtattg aaggagcggt cgactgtttc tcaatctcat cctttttata actttttatt      2520
     ggttgtttgt tttctttatt tcatatttta atcttttgga atgcaatcaa ctttttaaat      2580
     ggtgaagctg aattaaaaaa aaaaacttgt ttgtaaaaaa aaaaaaaaaa a               2631
//

If you have problems or comments...

PBIL Back to PBIL home page