(data stored in ACNUC9435 zone)

EMBL: BC097334

ID   BC097334; SV 1; linear; mRNA; STD; ROD; 2569 BP.
XX
AC   BC097334;
XX
DT   03-JUN-2005 (Rel. 84, Created)
DT   27-JUN-2005 (Rel. 84, Last updated, Version 3)
XX
DE   Rattus norvegicus early growth response 3, mRNA (cDNA clone MGC:114342
DE   IMAGE:7456458), complete cds.
XX
KW   MGC.
XX
OS   Rattus norvegicus (Norway rat)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Rattus.
XX
RN   [1]
RP   1-2569
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-2569
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (01-JUN-2005) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; 4ddcda977e18a7072203e4f3c72a7c2d.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Howard Jacobs
CC   cDNA Library Preparation: Express Genomics
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: Sequencing Group at the Stanford Human Genome
CC   Center, Stanford University School of Medicine, Stanford, CA  94305
CC   Web site:       http://www-shgc.stanford.edu
CC   Contact:  (Dickson, Mark) mcd@paxil.stanford.edu
CC   Dickson, M., Schmutz, J., Grimwood, J., Rodriquez, A., and Myers,
CC   R. M.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAK Plate: 227 Row: h Column: 17
CC   This clone was selected for full length sequencing because it
CC   passed the following selection criteria: matched mRNA gi: 8393304.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2569
FT                   /organism="Rattus norvegicus"
FT                   /lab_host="DH10B"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NIH_MGC_238"
FT                   /clone="MGC:114342 IMAGE:7456458"
FT                   /tissue_type="Testis, rat (Brown Norway)"
FT                   /note="Vector: pExpress1"
FT                   /db_xref="taxon:10116"
FT   gene            1..2569
FT                   /gene="Egr3"
FT   CDS_pept        410..1453
FT                   /codon_start=1
FT                   /gene="Egr3"
FT                   /product="Egr3 protein"
FT                   /db_xref="GOA:Q4V8L1"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR021849"
FT                   /db_xref="InterPro:IPR036236"
FT                   /db_xref="UniProtKB/TrEMBL:Q4V8L1"
FT                   /protein_id="AAH97334.1"
FT                   /translation="MEPCAAWSPHGGRENVMDIGLTNEKPNPELSYSGSFQPAPGNKTV
FT                   TYLGKFAFDSPSNWCQDNIISLMSAGILGVPPASGALSTQTTTASMVQPPQGDVEAMYP
FT                   ALPPYSNCGDLYSEPVSFHDPQGNPGLAYSPQDYQSAKPALDSNLFPMIPDYNLYHHPN
FT                   DMGSIPEHKPFQGMDPIRVNPPPITPLETIKAFKDKQIHPGFGSLPQPPLTLKPIRPRK
FT                   YPNRPSKTPLHERPHACPAEGCDRRFSRSDELTRHLRIHTGHKPFQCRICMRSFSRSDH
FT                   LTTHIRTHTGEKPFALPPGWSPESSGKSQSPRRRGRALISPWTCGPLASSSTPPISTLS
FT                   HRPAVGG"
XX
SQ   Sequence 2569 BP; 521 A; 857 C; 643 G; 548 T; 0 other;
     cacccgagag gattaccctc tctgcccctc tcccacccac ctccccaaaa aagaatagat        60
     cccctcccct gacccacccc ttcccctttt cactcccccc tccccccgaa ctttccctct       120
     cgcatgcttt tcccctgcac cacggatcgc ctctcggatg ccgctagcct ggaagctgcg       180
     ttaggaacag gcggcggcgg tggcggcggc ggcggcggtg gcggctgtag ctcgggagtg       240
     ctatgaccgg caaactcgcc gagaagctgc cggtgaccat gagcagtttg ctaaatcaat       300
     tgcctgacaa tctgtacccc gaggagatcc ccagcgcgct caacctcttc tccggcagca       360
     gtgactcggt agcccattac actcagatgg ctacagcctc ccacccggga tggagccatg       420
     tgcggcgtgg agtccccacg gtgggagaga gaatgtgatg gacatcggtc tgaccaacga       480
     gaagcccaat ccggaactct cttattcggg ctctttccag ccagccccag gcaacaagac       540
     cgtgacctac ttgggaaagt tcgctttcga ctctccttcc aactggtgcc aggacaacat       600
     cattagcctc atgagtgccg gcatcttggg ggtgcccccg gcctcagggg cgctcagtac       660
     gcagacgacc acggctagca tggtgcagcc tcctcaggga gacgtggagg ccatgtatcc       720
     ggcgctgccc ccctattcca actgcggcga cctctactcg gagccggtgt ctttccacga       780
     cccccagggg aacccagggc tcgcctattc cccccaggat taccaatcgg ccaagccggc       840
     cttggacagc aatcttttcc ccatgattcc tgactacaac ctgtatcacc accccaacga       900
     catgggctcc attccagaac acaagccctt ccagggcatg gaccccattc gggtcaaccc       960
     accccctatt acccctctgg agaccatcaa ggccttcaaa gacaagcaga tccacccggg      1020
     cttcggcagc ttgccccaac cgccgcttac tctcaagccc atccggcccc gcaagtaccc      1080
     caatcggcct agcaagaccc cactccacga gcggccccac gcgtgtcccg cggaaggctg      1140
     tgaccggcgt ttcagccgct cggacgagct gacccggcac ctgcgcatcc acacgggcca      1200
     caagcccttc cagtgtcgga tctgcatgcg cagcttcagc cgcagcgacc acctcactac      1260
     tcacatccgc acgcacaccg gggagaagcc ctttgccttg cctcctggct ggtcgcctga      1320
     aagcagcggg aaaagccagt caccgaggcg caggggccgc gccctgatct cgccctggac      1380
     gtgcggcccc cttgcctcct cttcgacgcc ccctatttcc accctttcac accggccggc      1440
     ggttgggggc tagggctaga ggcactttct ccttgctgcc ccctcttaac caaggcgtgg      1500
     gggtagaaag gtggcgtcta gcccgctttg ttcagttagg atcgccttga tccaggggcc      1560
     gctgggccac gccaaggacc tgcgggggac tgaaggcggg gcccatgcaa ccttcgccag      1620
     acccaagcac ctcactgttt ccccctccag tgtctccctg tgttccccct cgaacacccg      1680
     agagggggag ggggtaagga gcgcaccaaa gcgcagagct tgctgcccgc cgcacgcacg      1740
     cgcgcttgcg tgcggtgatg cgcgcgagtg tgtgcgtgct cgcctgtgtg tagtgtgcgt      1800
     gtgtatgtgt gtgagtgtgt tgtgtgcgcg cgcacacgtg tgtgtgagac tcttgagctg      1860
     aactgggctg tgtctactcc taaactcttc ttcacagaag gtccccaagc ctttgggaga      1920
     tgtcccaagc taaggaccag caagtgaccg gaggagatgg tcttccatct gctccttaat      1980
     gtttcttaca gaaatgcctc ggatgcagct actgctgcat cgggtttgac cccgtagaac      2040
     cccctccctt tccgagcgct tccctcttag gcctcggggc agtttgatct ttgggggagt      2100
     aagagccacc ttttttttta aaaaaagaaa tcatttgctc agccccactt ttcaaaacct      2160
     gtgttctcaa gcttgccctc tgcctctgcc tcccccaccc caccccgcgc gagccccatc      2220
     ttctcctttt ccctctcagg ttcgcactgc gtctctcaac atctttaccc agaaggcagg      2280
     cctcaaccac ccaagtgttt gtctctgtta catacccatt ccccattact gggaaggctg      2340
     gctctattca tttgccctct gtgatcacca acacaacaga agcgaagtgt atgtatatga      2400
     tgttggcgtg tgtatgtaga tgtatgtgtg tgtttcttta tacacatatg tttacataac      2460
     atgcactctg tattcctagc aaaatcaaat ctaaggcatt tggttatcca gtgcagtgca      2520
     ctggaataaa gagaatttgt aggcaaaaaa aaaaaaaaaa aaaaaaaaa                  2569
//

If you have problems or comments...

PBIL Back to PBIL home page